DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpinb1b

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:XP_038952280.1 Gene:Serpinb1b / 306891 RGDID:1560658 Length:380 Species:Rattus norvegicus


Alignment Length:409 Identity:109/409 - (26%)
Similarity:189/409 - (46%) Gaps:67/409 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FSLALMKQIREIYPSGNLFFSPFSTYNALLLAYF---SSSEQTERELAQALNLG---------WA 93
            |:|.|...:.|..|:||: |||||..:||.:.:.   .||..:...||:..:..         .:
  Rat    11 FALELFHTLSESSPTGNI-FSPFSISSALAMVFLGAKGSSAPSSLRLAETFHFDSVEDIHSRFQS 74

  Fly    94 LNKQQVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKF---NTLLYGA-TKELDFKN 154
            ||.              |.|...:...|..|||::.::|.|...:|   ...:||| ...:||::
  Rat    75 LNA--------------EMRKHGASHTLKVANRLYGEKTYNFLPEFLASTQKMYGADLAPVDFQH 125

  Fly   155 DPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFIN 219
            ..|...||||.|:..:|..:|.::|:...:...|.|||.||.|.||.|..:|....|...||.:|
  Rat   126 ASEDARKEINKWVKGQTEGKIPELLAGGVVNSTTKLVLVNAIYFKGIWQEKFLTRHTTDAPFRLN 190

  Fly   220 EREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILP---NS 281
            :::.:||.||::...|.......|:.:::::||:               ..::||:|:||   ..
  Rat   191 KKDTKMVKMMYQKEKFPFGYIPDLKCKVLEMPYQ---------------GGELSMVILLPEDIED 240

  Fly   282 NKISLNRVISRLNADSVKKWFERALPQKIE--LSLPKFQFEQRLELTPILSLMGVNTMFTRNATF 344
            ....|.::..:|..:.:.:|.:....::|:  ::||||:.|:...|...|..:|:..:|  :::.
  Rat   241 ESTGLQKIEEQLTLEKLYEWTKHENLKEIDVHVNLPKFKIEESYILNSNLGRLGLQDLF--SSSK 303

  Fly   345 GDLT--ADPISLVIDDAQHLAKIKVDEVGSTAAAAT-----ILLVSRSSRQPDPTKFNCNHPFVF 402
            .||:  ::...:.|....|.:.::|:|.|:.|||||     ..|||..:       |..:|||:|
  Rat   304 ADLSGMSESRDIFISKIVHKSFVEVNEEGTEAAAATAGLVEYCLVSIEA-------FIVDHPFLF 361

  Fly   403 LIYDEKVDTILFAGVYSDP 421
            .|.......:||.|....|
  Rat   362 FIRHNPTANMLFFGRVCSP 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 108/404 (27%)
Serpinb1bXP_038952280.1 serpinB1_LEI 1..380 CDD:381028 108/407 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.