DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpinb9d

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001100821.1 Gene:Serpinb9d / 306890 RGDID:1308725 Length:337 Species:Rattus norvegicus


Alignment Length:358 Identity:96/358 - (26%)
Similarity:175/358 - (48%) Gaps:46/358 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 TERELAQALNLG----WALNKQQVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINV--SNK 138
            |..:::|||||.    ..::|...|:.:.|.:.:..:.       |..|||:|.:.|..:  :.|
  Rat    10 TAVQISQALNLNKHPDEDIHKDFQLLLHNLNKPKSHYC-------LRIANRLFAENTCKLVPTYK 67

  Fly   139 FNTLLY--GATKELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQ 201
            .:.|.:  ...::|.|....|...|.||.|::.:|..:|.::|||:.:...|.|::.||.|.:|.
  Rat    68 ESCLRFYNSEIEQLSFAKAAEESRKHINTWVSKQTEGKIPELLSSDSVGSETKLIMVNALYFQGS 132

  Fly   202 WLSQFKVEETALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTP 266
            ||..|..|.|...||.||::|.:.|.||.:...|.:...:.:|:||:.:|||.:           
  Rat   133 WLHCFDKEFTMEMPFKINKKETKPVQMMWQEETFDVAYVKEIQAQILVMPYRGM----------- 186

  Fly   267 ESKSDISMIIILPNSNKISLNRVISRLNADSVKKWF--ERALPQKIELSLPKFQFEQRLELTPIL 329
                ::|.:::||:.. :.:.:|.|.|..:.:..|.  |.....::.:.|||||.:::.::|.:.
  Rat   187 ----EMSFMVLLPDEG-VDIRKVESSLTFEKLTAWTKPEFIYSTEVYVYLPKFQLQEQYDMTALF 246

  Fly   330 SLMGVNTMFTRNATFGDLTAD------PISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQ 388
            ..:|:..:|:      ::.||      ...|.:....|...::|:|.|:.||||:......|..:
  Rat   247 QHLGMIDVFS------EIKADLSGMCPEKDLCVSKFVHECVVEVNEEGTEAAAASAADCCYSCSE 305

  Fly   389 PDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDP 421
            ..|| |..:.||:|.|...:.::|||.|.:|.|
  Rat   306 YTPT-FCADRPFLFFIRHNQTNSILFCGRFSSP 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 94/353 (27%)
Serpinb9dNP_001100821.1 SERPIN 1..337 CDD:294093 95/356 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.