DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and RGD1564786

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:XP_006253935.2 Gene:RGD1564786 / 306889 RGDID:1564786 Length:420 Species:Rattus norvegicus


Alignment Length:436 Identity:115/436 - (26%)
Similarity:200/436 - (45%) Gaps:54/436 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 HTFSLVLLALLPVVTIAALDKPELSFLNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFSTY 66
            :||..|.:..:.::.         |.|.....:.|...:|::.|.|.:.|.. |.|:|||..|..
  Rat    23 YTFDCVFMMFIVILH---------SRLTIMDPLLKANGNFAIKLFKVLGEDI-SKNVFFSLPSIS 77

  Fly    67 NALLLAYFSSSEQTERELAQALNL------GWALNKQQVLVSYTLAQRQDEFRWRQSPMELSSAN 125
            :||.:....::..|..::.||::|      |.....|..|...|...:.|      :...|..||
  Rat    78 SALSMILMGANGTTASQICQAMSLDKCNSIGGGDVHQHFLSLLTKVNKTD------TRCMLRKAN 136

  Fly   126 RIFVDRTINVSNKFNTL---LYGA-TKELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITP 186
            .:|::.:..:...|...   ||.| .:|||||..||...:.||.|:|.||.:.||::|....:..
  Rat   137 SVFIEDSFEILASFKDACHKLYEAEIEELDFKGAPEQSRQHINTWVAKKTEDIIRELLPPCTVNS 201

  Fly   187 HTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLP 251
            :|.|.|.|..|.||.....|...:|...||.::..|::.|.||.:...||||..:.:.:|::.||
  Rat   202 NTCLFLVNVIYFKGSLEKPFNKADTREMPFKVSMNEKKTVQMMSQKSTFKMTYVKDISTQVLTLP 266

  Fly   252 YRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWF-ERALPQK-IELSL 314
            :               ..|.:||...:|:|: ::..::.:.|..|...:|. |..:.:| :|:.|
  Rat   267 F---------------ENSILSMYFFVPDSH-VAQRKLENELTYDKFLEWTDEDTMEEKEMEVFL 315

  Fly   315 PKFQFEQRLELTPILSLMGVNTMFTRN-ATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAAT 378
            |:.:.|:..::..:|..:|:...|..: |.|..:::.. .|.:....|.:.:::.|.|:.|||.|
  Rat   316 PRIKLEESYDMNGVLRKLGMTDAFEEDKADFSGISSKH-GLFLSKVVHKSFVEMSEEGTEAAAPT 379

  Fly   379 ILLVSRSSRQPDPTKFNC---NHPFVFLIYDEKVDTILFAGVYSDP 421
            .::..:|...|     .|   :|||:|.|.|.:...|||.|.:|.|
  Rat   380 DVVTMKSPLTP-----RCLIADHPFLFSIQDTRSKEILFLGRFSSP 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 107/396 (27%)
RGD1564786XP_006253935.2 SERPIN 46..420 CDD:294093 109/402 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.