DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and SERPIND1

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_000176.2 Gene:SERPIND1 / 3053 HGNCID:4838 Length:499 Species:Homo sapiens


Alignment Length:409 Identity:106/409 - (25%)
Similarity:185/409 - (45%) Gaps:47/409 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 QIFKGE----------RDFSLALMKQIR-EIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQ 86
            |:|.|:          ..|:..|.:.:: ::....|:|.:|.....|:.:.......:|..::..
Human   115 QLFHGKSRIQRLNILNAKFAFNLYRVLKDQVNTFDNIFIAPVGISTAMGMISLGLKGETHEQVHS 179

  Fly    87 ALNLGWALN---KQQVLVSYTLAQRQDE--FRWRQSPMELSSANRIFVDRTINVSNKFNTLL--- 143
            .|:....:|   |.::...:.|.::...  || |.....|.|.|.:::.:...:...|.|.:   
Human   180 ILHFKDFVNASSKYEITTIHNLFRKLTHRLFR-RNFGYTLRSVNDLYIQKQFPILLDFKTKVREY 243

  Fly   144 YGATKELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKV 208
            |.|..::...:|| ..:.:.|:.|...|...|:|.|  |.|.|.|.:::.|..|.||.|:::|.|
Human   244 YFAEAQIADFSDP-AFISKTNNHIMKLTKGLIKDAL--ENIDPATQMMILNCIYFKGSWVNKFPV 305

  Fly   209 EETALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDIS 273
            |.|....|.:||||...|.||...|.|....|:.|...|::|.|                ...||
Human   306 EMTHNHNFRLNEREVVKVSMMQTKGNFLAANDQELDCDILQLEY----------------VGGIS 354

  Fly   274 MIIILPNSNKIS-LNRVISRLNADSVKKWFERALPQKIELSLPKFQFEQRLELTPILSLMGVNTM 337
            |:|::|  :|:| :..:.::|....|::|.:....:..|:.||||:.|:...|...|.|||:..:
Human   355 MLIVVP--HKMSGMKTLEAQLTPRVVERWQKSMTNRTREVLLPKFKLEKNYNLVESLKLMGIRML 417

  Fly   338 FTRNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVF 402
            |.:|.....::...|:  ||..:|...|.|:|.|:.|...|.:.....|.|   .:|..:.||:|
Human   418 FDKNGNMAGISDQRIA--IDLFKHQGTITVNEEGTQATTVTTVGFMPLSTQ---VRFTVDRPFLF 477

  Fly   403 LIYDEKVDTILFAGVYSDP 421
            |||:.:...:||.|..::|
Human   478 LIYEHRTSCLLFMGRVANP 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 103/400 (26%)
SERPIND1NP_000176.2 HCII 62..497 CDD:239002 106/409 (26%)
Chemotactic activity 68..79
2 X 11 AA approximate repeats, Asp/Glu-rich (acidic) (hirudin-like) 73..97
Glycosaminoglycan-binding site 192..212 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.