DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpinc1

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001012027.1 Gene:Serpinc1 / 304917 RGDID:1307404 Length:465 Species:Rattus norvegicus


Alignment Length:429 Identity:120/429 - (27%)
Similarity:201/429 - (46%) Gaps:48/429 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLLALLPVVT---IAALDKPELSFLNEFSQIF---KGERDFSLALMKQIREIYPSGNLFFSPFST 65
            ||...:|..|   :..|.|....|...|.|..   |.:.|                |:|.||.|.
  Rat    68 VLEQKVPEATNRRVWELSKANSRFATNFYQHLADSKNDND----------------NIFLSPLSI 116

  Fly    66 YNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYTLAQRQDE-FRWRQSPMELSSANRIFV 129
            ..|..:....:...|.::|.:.........|....:.:..|:.... :|.......|.||||:|.
  Rat   117 STAFAMTKLGACNNTLKQLMEVFKFDTISEKTSDQIHFFFAKLNCRLYRKANKSSNLVSANRLFG 181

  Fly   130 DRTINVSNKF---NTLLYGA-TKELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTML 190
            |:::..:..:   :.::||| .:.||||.:||.....||:|:|:||..:|:|::....|...|.|
  Rat   182 DKSLTFNESYQDVSEIVYGAKLQPLDFKENPEQSRVTINNWVANKTEGRIKDVIPQGAIDELTAL 246

  Fly   191 VLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGAFK-MTIDEGLQSQIIKLPYRT 254
            ||.|..|.||.|.|:|..|.|..:||...:.:..:|.||::.|.|| ..:.||  :|::::|:: 
  Rat   247 VLVNTIYFKGLWKSKFSPENTRKEPFHKVDGQSCLVPMMYQEGKFKYRRVGEG--TQVLEMPFK- 308

  Fly   255 IYKSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQKIELSLPKFQF 319
                          ..||:|::|||...| ||.:|...|..:.:::|.:......:.:.:|:|:.
  Rat   309 --------------GDDITMVLILPKPEK-SLAKVEQELTPELLQEWLDELSEVMLVVHVPRFRI 358

  Fly   320 EQRLELTPILSLMGVNTMFT--RNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLV 382
            |....|...|..||:..:|:  ::...|.:......|.:.||.|.|.::|:|.||.|||:|.:::
  Rat   359 EDSFSLKEQLQDMGLVDLFSPEKSQLPGIIAEGRDDLFVSDAFHKAFLEVNEEGSEAAASTSVVI 423

  Fly   383 SRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDP 421
            :..|..|....|..|.||:.||.:..::||:|.|..|:|
  Rat   424 TGRSLNPSRVTFKANRPFLVLIREVALNTIIFMGRVSNP 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 108/388 (28%)
Serpinc1NP_001012027.1 antithrombin-III_like 80..459 CDD:239000 114/412 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.