DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpinb3

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001382662.1 Gene:Serpinb3 / 304688 RGDID:1549766 Length:387 Species:Rattus norvegicus


Alignment Length:409 Identity:119/409 - (29%)
Similarity:200/409 - (48%) Gaps:50/409 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALN--KQQ 98
            |....|:|.|.:|:|:  ...|:|:||.|...||.:....:...||:::.:||.|.....  |::
  Rat     6 KATTQFTLELYRQLRD--SEDNIFYSPLSIMTALAMLQLGAKGNTEKQIEKALQLSETTKKPKEK 68

  Fly    99 VLVSYTLAQRQDEFRWRQSPM-------ELSSANRI-------FVDRTINVSNKFNTLLYGATKE 149
            ...|:......::||...:.:       :|.|.|.|       |:...:....|:    |.|..|
  Rat    69 SADSHDEENVHEQFRKIMNQLNKSNGAYDLKSPNSIYGAKGFPFLQTFMEDIKKY----YQANVE 129

  Fly   150 -LDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETAL 213
             |||.:..|...|:||.|:.:||:.:|:|:.....:...|:|||.||.|.||||..:|..:.|..
  Rat   130 SLDFAHAAEESQKKINSWVENKTNGKIKDLFPRGSLNSSTILVLVNAVYFKGQWNHKFDEQRTRE 194

  Fly   214 KPFFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIIL 278
            ..|::|:...:.|.||.:|..|.....|.:|::::::|    ||.||           :||.|:|
  Rat   195 DKFWLNKNTSKPVQMMRQTNEFNFIFLEDVQAKMVEIP----YKGKE-----------LSMFILL 244

  Fly   279 PNSNKISLNRVISRLNADSVKKWFERALPQ-----KIELSLPKFQFEQRLELTPILSLMGVNTMF 338
            |.... .|.::..:|:||::..|   ..|:     ::.||||:|:.:::.:|...|..||:...|
  Rat   245 PMEID-GLKKLEEKLSADTLLAW---TSPKNMRMTQLNLSLPRFKVQEKYDLPGPLEHMGMVDAF 305

  Fly   339 T-RNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVF 402
            . :.|.|..:::.. .||:....|.:.::|:|.|:.||||| .:.:|....|..|:|.||.||:.
  Rat   306 NPQKADFSGMSSTK-GLVVSKVLHKSFLEVNEEGAEAAAAT-GVETRILSAPRTTEFTCNRPFIV 368

  Fly   403 LIYDEKVDTILFAGVYSDP 421
            .|.....::|||.|..|.|
  Rat   369 FIKPNNTNSILFFGRVSSP 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 116/403 (29%)
Serpinb3NP_001382662.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.