DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and LOC299277

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:XP_008763124.2 Gene:LOC299277 / 299277 RGDID:1595900 Length:420 Species:Rattus norvegicus


Alignment Length:404 Identity:96/404 - (23%)
Similarity:175/404 - (43%) Gaps:44/404 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LDKPELSFLNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTEREL 84
            ||...|:.:|         .||:.:|.|::....|:.|:.|||.|...||......:...|.:|:
  Rat    42 LDSGTLASIN---------TDFAFSLYKELALKNPNKNIAFSPLSISAALASLSLGAKGNTLQEI 97

  Fly    85 AQALNLGWALNKQ-QVLVSY-TLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKF----NTLL 143
            .:.|........: .:..:| .|.||..:   .....::|.||.:||::.:.:.|.|    ..|.
  Rat    98 LEGLKFNLTETTEIDIHQNYRDLLQRLSQ---PGGQGQISRANLLFVEKHLQILNGFKEKAKALY 159

  Fly   144 YGATKELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKV 208
            .......||:...| ..|.|||::..::..:|::|::  |:...|.:|:.|.....|||...|..
  Rat   160 QTEVFATDFQQTCE-ARKFINDYVMIQSQGKIKEMVT--ELEERTSIVMLNFLLFTGQWSVPFDP 221

  Fly   209 EETALKPFFINEREQEMVYMMHKTGAFKMTI--DEGLQSQIIKLPYRTIYKSKETHISTPESKSD 271
            ::|.:..|.::.|....|.|| ||.......  ||.|:..:::|.|:...|:             
  Rat   222 DDTFMGKFILDSRRPVKVLMM-KTEDLTTPYFWDEELKCTVVELNYKGHGKA------------- 272

  Fly   272 ISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQKI-ELSLPKFQFEQRLELTPILSLMGVN 335
               :.|||:..|  :.:|.:.|:..:::||.:...|:.| ||.||||...:..:|..||..:|:.
  Rat   273 ---MFILPDQGK--MEQVEASLHPGTLRKWTDSLKPRIIDELHLPKFSLSKTYKLENILPELGIM 332

  Fly   336 TMFTRNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPF 400
            .:|...|....: |....:.:....|...:.:.|.|:.|.|.|.:..:....:.:.|..|....|
  Rat   333 DVFNTQADLSGI-AGAKDVRVSQMIHNTVLGMAETGTEAEATTRVEYNFRPAKLNDTFVNFVRKF 396

  Fly   401 VFLIYDEKVDTILF 414
            ::::.:...:.|.|
  Rat   397 LYMVLEPNSELISF 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 92/387 (24%)
LOC299277XP_008763124.2 serpinA3_A1AC 37..417 CDD:381019 96/404 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.