DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpina3m

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001257911.1 Gene:Serpina3m / 299276 RGDID:735068 Length:419 Species:Rattus norvegicus


Alignment Length:430 Identity:110/430 - (25%)
Similarity:182/430 - (42%) Gaps:83/430 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LDKPELSFLNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTEREL 84
            ||...|..:|         .||:.:|.|.:....|..|:.|||.|...||.:....:...|..|:
  Rat    42 LDSLTLESIN---------TDFAFSLYKMLALKNPDKNVVFSPLSISAALAIVSLGAKGNTLEEI 97

  Fly    85 AQAL--NL------------GWALNKQQVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINV 135
            .:.|  ||            |..|.:        |:|..|:       :::.:.|.:|:|:.:.|
  Rat    98 LEVLRFNLTESYETDIHQGFGHLLQR--------LSQPGDQ-------VKIITGNALFIDKNLQV 147

  Fly   136 SNKFNTLLYGATKEL--------DFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVL 192
            ..:|..    .|:.|        ||: .|....|.|||::.::|..:|::::|.  :...|.:||
  Rat   148 LAEFQE----KTRALYQVEAFTADFQ-QPRVTEKLINDYVRNQTQGKIQELVSG--LKERTSMVL 205

  Fly   193 ANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMH----KTGAFKMTIDEGLQSQIIKLPYR 253
            .|....:|:|...|..:.|....|:::|:....|.||.    .|..|:   ||.|...:::|.| 
  Rat   206 VNYLLFRGKWKVPFDPDYTFESEFYVDEKRSVKVSMMKIEELTTPYFR---DEELSCSVLELKY- 266

  Fly   254 TIYKSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQKI-ELSLPKF 317
                           ..:.|.:.|||:..:  :.:|.:.|..:::|||.:...|:|| ||.||:.
  Rat   267 ---------------TGNSSALFILPDKGR--MQQVEASLQPETLKKWKDSLRPRKIDELYLPRL 314

  Fly   318 QFEQRLELTPILSLMGVNTMFTRNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAAT-ILL 381
            .......|..:|..:|:..:|::.|....:|... .|.:....|...:.|:|.|:.||||| ..|
  Rat   315 SISTDYSLEEVLPELGIRDVFSQQADLSRITGAK-DLSVSQVVHKVVLDVNETGTEAAAATGANL 378

  Fly   382 VSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDP 421
            |.||.|.|....|  |.||:..:......||||.....:|
  Rat   379 VPRSGRPPMIVWF--NRPFLIAVSHTHGQTILFMAKVINP 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 105/408 (26%)
Serpina3mNP_001257911.1 SERPIN 56..416 CDD:214513 103/405 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.