DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpina9

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001100224.1 Gene:Serpina9 / 299274 RGDID:1304789 Length:417 Species:Rattus norvegicus


Alignment Length:417 Identity:110/417 - (26%)
Similarity:186/417 - (44%) Gaps:60/417 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQAL----- 88
            |..||:......|:..|.:::.:..|..|:.|||.|...:|.:....:...|:.::.::|     
  Rat    40 NPASQVTPSNTKFAFLLYQRLAQKSPGQNILFSPVSISTSLAMLSLGACSATKTQILRSLGFNIT 104

  Fly    89 -------NLGWALNKQQVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKF---NTLL 143
                   :||:    :|::.|.....:.         :||...:.:|:.:.:.:..||   ...|
  Rat   105 HIAEHTIHLGF----EQLVHSLNECHKD---------LELRMGSVLFIRKELQLQVKFLDRVKKL 156

  Fly   144 YGATKEL--DFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQF 206
            || ||..  ||.| ..|...:||.::..:|..::.|::  :::...|.:||.|..:.|..|...|
  Rat   157 YG-TKVFSEDFSN-AVTAQAQINSYVERETKGKVVDVI--QDLDSQTAMVLVNHIFFKANWTQPF 217

  Fly   207 KVEETALK-PFFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKS 270
            ....|... ||.:::.....|.|||:|.:|...:|..|...|:::.||                .
  Rat   218 SAANTNKSFPFLLSKGTTVHVPMMHQTESFAFGVDRELGCSILQMDYR----------------G 266

  Fly   271 DISMIIILPNSNKISLNRVISR-LNADSVKKWFERALPQK-IELSLPKFQFEQRLELTPILSLMG 333
            |.....:||...|:   |.:.| |:...:::| .|:|.:: |::.:|||.......|..||..||
  Rat   267 DAVAFFVLPGKGKM---RQLERSLSPRRLRRW-SRSLQKRWIKVFIPKFSISASYNLETILPEMG 327

  Fly   334 VNTMFTRNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATIL-LVSRSSRQPDPTKFNCN 397
            :...|..||.|..:|.... |.:..|.|.|.:.|.|.|:.|||||.. |:.||...|..| ...|
  Rat   328 IRDAFNSNADFSGITKTHF-LQVSKAAHKAVLDVSEEGTEAAAATTTKLIVRSRDTPSST-IAFN 390

  Fly   398 HPFVFLIYDEKVDTILFAGVYSDPRQM 424
            .||:.|:.|:..::|||.|...:||:|
  Rat   391 EPFLILLLDKNTESILFLGKVENPRKM 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 104/401 (26%)
Serpina9NP_001100224.1 serpin 32..417 CDD:422956 109/415 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.