DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpina6

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001009663.1 Gene:Serpina6 / 299270 RGDID:1595901 Length:396 Species:Rattus norvegicus


Alignment Length:405 Identity:91/405 - (22%)
Similarity:173/405 - (42%) Gaps:74/405 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NEFSQIFKG----ERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAY-------------FSS 76
            ||.|...:|    ..||:..|.:::..:.|..|...||.|...||.:..             |:.
  Rat    25 NESSNSHRGLAPTNVDFAFNLYQRLVALNPDKNTLISPVSISMALAMVSLGSAQTQSLQSLGFNL 89

  Fly    77 SEQTERELAQALNLGWALNKQQVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKF-- 139
            :|.:|.|:.|:..          .::|.|.|       ..:.:|::..|.:|:.:.:.:.:.|  
  Rat    90 TETSEAEIHQSFQ----------YLNYLLKQ-------SDTGLEMNMGNAMFLLQKLKLKDSFLA 137

  Fly   140 NTLLYGATKEL--DFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQW 202
            :...|..::.|  ||: |.....::||..:.|||..:|..:.|  ::......:|.|..:::|.|
  Rat   138 DVKQYYESEALAIDFE-DWTKASQQINQHVKDKTQGKIEHVFS--DLDSPASFILVNYIFLRGIW 199

  Fly   203 LSQFKVEETALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPE 267
            ...|..|.|..:.|::||.....|.||.::|:.....|.....|:|::.|               
  Rat   200 ELPFSPENTREEDFYVNETSTVKVPMMVQSGSIGYFRDSVFPCQLIQMDY--------------- 249

  Fly   268 SKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQKIELSLPKFQFEQRLELTPILSLM 332
             ..:.:...|||:..:  ::.||:.|:.|::.:|.:...|:::.|.:|||......:|..:|..:
  Rat   250 -VGNGTAFFILPDQGQ--MDTVIAALSRDTIDRWGKLMTPRQVNLYIPKFSISDTYDLKDMLEDL 311

  Fly   333 GVNTMFTRNATFGDLTAD-PISLVIDDAQHLAKIKVDE----VGSTAAAATILLVSRSSRQPDPT 392
            .:..:.|..:.|...|.| |::|.:   .|.|.:::||    ..||..|...|       :.:|.
  Rat   312 NIKDLLTNQSDFSGNTKDVPLTLTM---VHKAMLQLDEGNVLPNSTNGAPLHL-------RSEPL 366

  Fly   393 KFNCNHPFVFLIYDE 407
            ....|.||:.|::|:
  Rat   367 DIKFNKPFILLLFDK 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 88/397 (22%)
Serpina6NP_001009663.1 alpha-1-antitrypsin_like 37..392 CDD:239011 87/393 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.