DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpine2

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_062070.1 Gene:Serpine2 / 29366 RGDID:3748 Length:397 Species:Rattus norvegicus


Alignment Length:427 Identity:113/427 - (26%)
Similarity:188/427 - (44%) Gaps:54/427 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLPVVTIAALDKPELSFLNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFS 75
            :|..||::::    .|.||..|....|. |..:.:..||.:..|..|:..||....:.|.:....
  Rat     9 ILTTVTLSSV----YSQLNSLSLEELGS-DTGIQVFNQIIKSQPHENVVISPHGIASILGMLQLG 68

  Fly    76 SSEQTERELAQAL-----NLGWALNK-QQVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTIN 134
            :..:|:::|:..:     .:|..|.| .:.:||            :::...::.||.:||.....
  Rat    69 ADGRTKKQLSTVMRYNVNGVGKVLKKINKAIVS------------KKNKDIVTVANAVFVRNGFK 121

  Fly   135 VSNKF----NTLLYGATKELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEI-TPHTMLVLAN 194
            |...|    ..:.....:.::|: ||.:....||.|:.::|...|.::||...| :..|.|||.|
  Rat   122 VEVPFAARNKEVFQCEVQSVNFQ-DPASACDAINFWVKNETRGMIDNLLSPNLIDSALTKLVLVN 185

  Fly   195 AAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGAFK---MTIDEGLQSQIIKLPYRTIY 256
            |.|.||.|.|:|:.|.|..:.|...:.:...|.|:.:...|:   .....||....|:|||.   
  Rat   186 AVYFKGLWKSRFQPENTKKRTFVAGDGKSYQVPMLAQLSVFRSGSTKTPNGLWYNFIELPYH--- 247

  Fly   257 KSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQKIELSLPKFQFEQ 321
                        ...|||:|.||..:...|:.:|..::..::..|....:|::::|.||||....
  Rat   248 ------------GESISMLIALPTESSTPLSAIIPHISTKTINSWMNTMVPKRMQLVLPKFTAVA 300

  Fly   322 RLELTPILSLMGVNTMF-TRNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAA-AATILLVSR 384
            :.:|...|..:|:..|| ...|.|..:|... ||.:......|||:|.|.|:.|| ..|.:|::|
  Rat   301 QTDLKEPLKALGITEMFEPSKANFAKITRSE-SLHVSHILQKAKIEVSEDGTKAAVVTTAILIAR 364

  Fly   385 SSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDP 421
            ||    |..|..:.||:|.|.......|||.|..:.|
  Rat   365 SS----PPWFIVDRPFLFCIRHNPTGAILFLGQVNKP 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 105/396 (27%)
Serpine2NP_062070.1 serpinE2_GDN 21..395 CDD:381039 108/407 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.