DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpinh1

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_058869.2 Gene:Serpinh1 / 29345 RGDID:69302 Length:417 Species:Rattus norvegicus


Alignment Length:452 Identity:95/452 - (21%)
Similarity:175/452 - (38%) Gaps:73/452 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHTFSLVLLALLPVVTIAALDKP----------ELSFLNEFSQIFKGERDFSLALMKQIREIYPS 55
            |.:..|..|.||.|...|.:.||          :||  ::.:.:.:.....:.:|.:.:.:....
  Rat     1 MRSLLLGTLCLLAVALAAEVKKPVEATAPGTAEKLS--SKATTLAERSTGLAFSLYQAMAKDQAV 63

  Fly    56 GNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYTLAQRQDEFRWRQSPME 120
            .|:..||....::|.|........|            |...:.||.:..|  |.:|.......:.
  Rat    64 ENILLSPLVVASSLGLVSLGGKATT------------ASQAKAVLSAEKL--RDEEVHTGLGELL 114

  Fly   121 LSSANRIFVDRTINVSNKFNTLLYGAT--------------------KELDFKNDPETGLKEIND 165
            .|.:|    ....||:.|..:.|||.:                    .:::|: |..:.|:.||:
  Rat   115 RSLSN----STARNVTWKLGSRLYGPSSVSFADDFVRSSKQHYNCEHSKINFR-DKRSALQSINE 174

  Fly   166 WIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMH 230
            |.:..|..::.::....|.|...:||  ||.:.|..|..:|..:....:.|.:.......|.|||
  Rat   175 WASQTTDGKLPEVTKDVERTDGALLV--NAMFFKPHWDEKFHHKMVDNRGFMVTRSYTVGVTMMH 237

  Fly   231 KTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNA 295
            :||.:....||..:.|::::|.        .|..:       |:||::|:..: .|.|:...|..
  Rat   238 RTGLYNYYDDEKEKLQLVEMPL--------AHKLS-------SLIILMPHHVE-PLERLEKLLTK 286

  Fly   296 DSVKKWFERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTADPISLVIDDAQ 360
            :.:|.|..:...:.:.:||||...|...:|...|:.:|:.....:|.......:....|.:....
  Rat   287 EQLKTWMGKMQKKAVAISLPKGVVEVTHDLQKHLAGLGLTEAIDKNKADLSRMSGKKDLYLASVF 351

  Fly   361 HLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDPR 422
            |....:.|..|:.....   :..|...: .|..|..:|||:||:.|.:..::||.|....|:
  Rat   352 HATAFEWDTEGNPFDQD---IYGREELR-SPKLFYADHPFIFLVRDNQSGSLLFIGRLVRPK 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 83/400 (21%)
Serpinh1NP_058869.2 serpinH1_CBP1 35..416 CDD:381003 86/418 (21%)
Prevents secretion from ER. /evidence=ECO:0000305 414..417
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.