DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpinb1a

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001026812.1 Gene:Serpinb1a / 291091 RGDID:1306203 Length:379 Species:Rattus norvegicus


Alignment Length:392 Identity:107/392 - (27%)
Similarity:190/392 - (48%) Gaps:34/392 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYTL 105
            |:|.|...:.|..|:||:||||||..:||.:.:..:...|..:|::..:.....:     |....
  Rat    11 FALELFHTLSESSPTGNIFFSPFSISSALAMVFLGTKGTTAAQLSKTFHFDSVED-----VHSRF 70

  Fly   106 AQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFNT---LLYGA-TKELDFKNDPETGLKEINDW 166
            .....|...|.:...|..|||::.::|.|...:|.|   .:||| ...:||::..|...||||.|
  Rat    71 QSLNAEVSKRGASHTLKLANRLYGEKTYNFLPEFLTSTQKMYGADLAPVDFQHASEDARKEINQW 135

  Fly   167 IADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHK 231
            :..:|..:|.::|:...:...|.|||.||.|.||.|..:|..::|...||.:|::..:.|.||::
  Rat   136 VKGQTEGKIPELLAVGVVDSMTKLVLVNAIYFKGMWEEKFMKQDTTDAPFRLNKKNTKSVKMMYQ 200

  Fly   232 TGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILP---NSNKISLNRVISRL 293
            ...|.......|:.:::::||:               ..::||:|:||   ......|.::..::
  Rat   201 KKKFFFGYISDLKCKVLEMPYQ---------------GGELSMVILLPEDIEDESTGLKKIEEQI 250

  Fly   294 NADSVKKWFERALPQKIE--LSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLT--ADPISL 354
            ..:.:::|.:|...:.|:  :.||:|:.|:...|...|..:|:..:|  |::..||:  :....|
  Rat   251 TLEKLREWTKRENLENIDVHVKLPRFKIEESYILNSNLGRLGLQDLF--NSSKADLSGMSGSRDL 313

  Fly   355 VIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYS 419
            .|....|.|.::|:|.|:.|||||..:.:.....|: .:|..:|||:|.|.......:||.|...
  Rat   314 FISKIVHKAFVEVNEEGTEAAAATAGIATFCMLLPE-EEFTADHPFIFFIRHNPTANVLFLGRVC 377

  Fly   420 DP 421
            .|
  Rat   378 SP 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 106/387 (27%)
Serpinb1aNP_001026812.1 SERPIN 4..379 CDD:294093 106/390 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.