DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpinb6e

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:XP_006253937.2 Gene:Serpinb6e / 291087 RGDID:1561697 Length:379 Species:Rattus norvegicus


Alignment Length:407 Identity:108/407 - (26%)
Similarity:198/407 - (48%) Gaps:51/407 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNL-------G 91
            :.:....|:|.:::.:.| ..|.|:||||.|.:::|.:....::..|..::::.|:|       |
  Rat     4 LLEANATFALKVLRVLGE-DSSKNVFFSPLSMFSSLSMILLGANGTTASQISKVLSLYNCNGNGG 67

  Fly    92 WALNK--QQVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFN---TLLYGATKE-L 150
            ...::  |.:|.....:.|:.         .|.::|.:||:.:..:...|.   ...|.|..| :
  Rat    68 GDFHQCFQSLLTEVNKSDRRH---------MLKTSNSVFVEDSFEILASFKDSCRKFYEAEIENM 123

  Fly   151 DFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKP 215
            |||..||...:.||.|:|.||.:.||::||...:..:|.|||.|:.|.||.|...|..|:|...|
  Rat   124 DFKGAPEQSRQHINTWVAKKTEDVIRELLSPGTVNSNTQLVLMNSFYFKGNWEKPFNKEDTREMP 188

  Fly   216 FFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPN 280
            |.:::.|:::|.||.....|:....|.:.:.:..|||               ..:.:|:.|:||:
  Rat   189 FKVSKNEKKIVQMMFNKSNFRTYHVEDISTTLALLPY---------------LGNQLSITIMLPD 238

  Fly   281 SNKISLNRVISRLNADSVKKW--FERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMF-TRNA 342
             ..:.|..|.:::..:.:.:|  .|....:::|:.||:|:.|:..::..:|..:|:...| ...|
  Rat   239 -EYVELRTVENQITYEKLIEWTRLENMQEEEVEILLPRFKLEESYDMKNVLCKLGMTNAFEDGRA 302

  Fly   343 TFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNC---NHPFVFLI 404
            .|..:::.| .|.:....|.:.::|:|.|:.|||.|.::...|...|     .|   :|||:|||
  Rat   303 DFSGISSKP-GLFLSKVVHKSVVEVNEEGTEAAAPTEIVTMGSPLSP-----QCLVADHPFLFLI 361

  Fly   405 YDEKVDTILFAGVYSDP 421
            .|::...|||.|.:|.|
  Rat   362 QDDRNKAILFLGRFSSP 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 106/399 (27%)
Serpinb6eXP_006253937.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.