DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpinb6a

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:XP_006253933.1 Gene:Serpinb6a / 291085 RGDID:735108 Length:400 Species:Rattus norvegicus


Alignment Length:402 Identity:121/402 - (30%)
Similarity:198/402 - (49%) Gaps:44/402 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNL-------GWA 93
            :|...|:|.|:|.:.| ..|.|:|.||.|...||.:.:..:...|..::.|.|:|       |..
  Rat    27 EGNGIFALKLLKTLSE-DSSNNIFLSPISISAALTMVFMGAKGMTASQMVQTLSLDKCSGNGGGD 90

  Fly    94 LNK--QQVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFNTL---LYGA-TKELDF 152
            :::  |.:|........|         ..|.:|||:|.::|.::...|...   .|.| .:||||
  Rat    91 VHQGFQSLLAEVNKTGTQ---------YLLKTANRLFGEKTCDILASFKDACRKFYEAEMEELDF 146

  Fly   153 KNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFF 217
            |.|.|...:.||.|:|.||.::|:::|:...:.|.|:|||.||.|.||.|..||..|.|..|||.
  Rat   147 KGDTEQSRQRINTWVAKKTEDKIKELLAPGIVDPDTVLVLVNAIYFKGNWDKQFNKEHTREKPFK 211

  Fly   218 INEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSN 282
            :::.|::.|.||.....||||....:.::|:.|||               :.::::|||:||:.:
  Rat   212 VSKTEEKPVQMMFMKSTFKMTYIGEIFTKILLLPY---------------AGNELNMIIMLPDEH 261

  Fly   283 KISLNRVISRLNADSVKKW--FERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTR-NATF 344
             |.|..|...|..:...:|  .:....:::|:.||:|:.|:..::..:|..:|:...|.. .|.|
  Rat   262 -IELKTVEKELTYEKFIEWTRLDMLDEEEVEVFLPRFKLEENYDMKVVLGKLGMTDAFMEGRADF 325

  Fly   345 GDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKV 409
            ..: |....|.:....|.|.::|:|.|:.|.|||...::....:..| :|..:|||:|.|...|.
  Rat   326 SGI-ASKQGLFLSKVIHKAFVEVNEEGTEAVAATGSTITMRCLRFTP-RFLADHPFLFFIQHVKT 388

  Fly   410 DTILFAGVYSDP 421
            ..|||.|.:|.|
  Rat   389 KGILFCGRFSSP 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 119/396 (30%)
Serpinb6aXP_006253933.1 SERPIN 25..400 CDD:294093 120/400 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.