DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpinb8

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001099418.1 Gene:Serpinb8 / 288937 RGDID:1309833 Length:375 Species:Rattus norvegicus


Alignment Length:394 Identity:115/394 - (29%)
Similarity:194/394 - (49%) Gaps:42/394 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNL---GWALNKQQVLVS 102
            |:::|:|.:.|...|.||||.|.|..:||.:.|..:...|..:::|.|.|   |......|.|::
  Rat    11 FAISLLKILGEEDKSRNLFFCPMSVSSALAMVYLGAKGNTATQMSQVLGLSGDGDVHQGFQTLLA 75

  Fly   103 YTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKF----NTLLYGATKELDFKNDPETGLKEI 163
                    |.....:...|.||.|:|.:.:.:..:.|    ........:|:.|..|.|...|.|
  Rat    76 --------EVNKSGTQYLLKSACRLFGEESCDFLSTFKESCQKFYQAGIEEMSFVKDTEGCRKRI 132

  Fly   164 NDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYM 228
            |||:.:||..:|.::||...:.|.|.|||.||.|.||:|.:||..:.|...||..|:.|::.|.|
  Rat   133 NDWVLEKTEGKISEVLSPGTVCPLTKLVLVNAMYFKGKWKAQFDRKYTRGMPFKTNQEEKKTVQM 197

  Fly   229 MHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRVISRL 293
            |.|...|||...:.:.:|::.|||               ::.::||:::||:.:. .|..|...|
  Rat   198 MFKHAKFKMAHVDEVNAQVLALPY---------------AEDELSMVVLLPDESS-DLTVVEKAL 246

  Fly   294 NADSVKKWF--ERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTR-NATFGDLTAD---PI 352
            ..:.::.|.  |.....|:::..|:.:.|:..:|..:|..:|:...|.. .|.|..:|:.   |:
  Rat   247 TYEKLRAWTNPETLTESKVQVFFPRLKLEESYDLETVLQSLGMTDAFEETKADFSGMTSKKNVPV 311

  Fly   353 SLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGV 417
            |.|    .|...::|:|.|:.|||.|.::.:..|.:.:| :|..:.||:|.|:.:|..:|||.|.
  Rat   312 SKV----AHKCFVEVNEEGTEAAATTAVIRNTRSCRIEP-RFCADRPFLFFIWHQKTSSILFCGR 371

  Fly   418 YSDP 421
            :|.|
  Rat   372 FSSP 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 113/389 (29%)
Serpinb8NP_001099418.1 SERPIN 4..375 CDD:294093 114/392 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.