DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpinf2

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001011892.1 Gene:Serpinf2 / 287527 RGDID:1306692 Length:491 Species:Rattus norvegicus


Alignment Length:387 Identity:104/387 - (26%)
Similarity:176/387 - (45%) Gaps:45/387 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQAL--NLGWALNKQQVLVSY 103
            |:..|...:.:...|.||..||.|...||......:..||...|.:.|  |:|..:..   |:|:
  Rat    89 FTTDLFSLVAQTSTSSNLVLSPLSVALALSHLALGARNQTLENLQRVLHMNMGSCIPH---LLSH 150

  Fly   104 TLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKF---NTLLYGATKELDFKNDPETGLKEIND 165
                    |....:|..:..|.||::.:...:.:.|   :..|:|| |.:......|..|..||.
  Rat   151 --------FCQNLNPGTIRLAARIYLQKGFPIKDDFLEQSEKLFGA-KPVKLTGRQEEDLMNINK 206

  Fly   166 WIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMH 230
            |:.:.|..:|.|.||  |:..:|:|:|.||.:..|.|.::|....|....|.::|:....|.|||
  Rat   207 WVKEATEGKIEDFLS--ELPDNTVLLLLNAIHFHGFWRTKFDPSLTQKDSFHLDEQFTVPVAMMH 269

  Fly   231 -KTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRVISRLN 294
             ::...:..:.|..:.|:...|:                ::::|.::|:|.....:::.|::.|.
  Rat   270 AQSYPLRWFLLEQPEIQVAHFPF----------------QNNMSFVVIMPTYFGWNVSEVLANLT 318

  Fly   295 ADSVKKWFERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTADPISLVIDDA 359
            .|::.:...|..|.|:.  |||...||.|:|...||.:|:..:|......|  .:|. |||:...
  Rat   319 WDTLYQPSMREKPTKVR--LPKLHLEQHLDLVATLSKLGLQDLFQSPDLRG--ISDQ-SLVVSSV 378

  Fly   360 QHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDP 421
            ||.:.:::.|.|..|||||...::|.|.    :.|..|.||:|.|.:|.:...||.|...:|
  Rat   379 QHQSTMELSEAGVEAAAATSTAMTRMSL----SSFFLNRPFIFFIMEETIGIPLFVGSVRNP 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 103/382 (27%)
Serpinf2NP_001011892.1 alpha2AP 82..433 CDD:239008 103/382 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.