DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpinf1

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_808788.1 Gene:Serpinf1 / 287526 RGDID:631369 Length:418 Species:Rattus norvegicus


Alignment Length:386 Identity:94/386 - (24%)
Similarity:162/386 - (41%) Gaps:64/386 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 SGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNK------QQVLVSYTLAQRQDEFR 113
            :||:..||.|...||......:.::||..:.:||......|.      :::|.|.|..::     
  Rat    75 TGNILLSPLSVATALSALSLGAEQRTESVIHRALYYDLINNPDIHSTYKELLASVTAPEK----- 134

  Fly   114 WRQSPMELSSANRIFVDRTINVSNKFNTLL---YGATKELDFKNDPETGLKEINDWIADKTHNQI 175
                  ...||:||..:|.:.|.:.|...|   || |:......:|...|:|||:|:..:...:|
  Rat   135 ------NFKSASRIVFERKLRVKSSFVAPLEKSYG-TRPRILTGNPRIDLQEINNWVQAQMKGKI 192

  Fly   176 RDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGA-FKMTI 239
              ..|:.|:.....::|...||.||||.::|...:|.|:.|.::|.....|.||....| .:..:
  Rat   193 --ARSTREMPSALSILLLGVAYFKGQWATKFDSRKTTLQDFHLDEDRTVRVPMMSDPKAILRYGL 255

  Fly   240 DEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFER 304
            |..|..:|.:||.                ...:|:|..||.:...:|..:...|.::.|.. .:|
  Rat   256 DSDLNCKIAQLPL----------------TGSMSIIFFLPLTVTQNLTMIEESLTSEFVHD-IDR 303

  Fly   305 ALPQ-KIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTADPISLVIDDAQHLAKIKVD 368
            .|.. :..|::||.:.....::|..|..|.:.::| .:..|..:|..|:.|.  ..:|.|..:.:
  Rat   304 ELKTIQAVLTVPKLKLSYEGDVTNSLQDMKLQSLF-ESPDFSKITGKPVKLT--QVEHRAAFEWN 365

  Fly   369 EVGSTAAAATILLVSRSSRQPD--------PTKFNCNHPFVFLIYDEKVDTILFAGVYSDP 421
            |.|           :.:|..||        |..::.|.||:|::.|.....:||.|...||
  Rat   366 EEG-----------AGTSSNPDLQPVRLTFPLDYHLNRPFIFVLRDTDTGALLFIGRILDP 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 92/381 (24%)
Serpinf1NP_808788.1 PEDF 40..415 CDD:239007 92/384 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.