DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and HMSD

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:XP_016881199.1 Gene:HMSD / 284293 HGNCID:23037 Length:217 Species:Homo sapiens


Alignment Length:148 Identity:39/148 - (26%)
Similarity:61/148 - (41%) Gaps:46/148 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 STYNALLLAYFSSSEQTERELAQAL------------NLGWALNKQQVLVSYTLAQRQDEFRWRQ 116
            |..:||.:.:..:...|..:::|||            :.|:    |.:||:   ..|.|      
Human     2 SISSALAMVFMGAKGNTAAQMSQALCFSKIGGEDGDIHRGF----QSLLVA---INRTD------ 53

  Fly   117 SPMELSSANRIFVDRTINVSNKFNT---LLYGAT-KELDFKNDPETGLKEINDWIADKT------ 171
            :...|.:||.:|.:::.:....|..   ..|.|| |:|||.||.|.....:|.|:||||      
Human    54 TEYVLRTANGLFGEKSYDFLTGFTDSCGKFYQATIKQLDFVNDTEKSTTRVNSWVADKTKVHKGT 118

  Fly   172 --HNQIRDMLSSEEITPH 187
              |:|.|         ||
Human   119 KKHHQQR---------PH 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 39/148 (26%)
HMSDXP_016881199.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.