DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpinb1b

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_766640.1 Gene:Serpinb1b / 282663 MGIID:2445361 Length:382 Species:Mus musculus


Alignment Length:395 Identity:107/395 - (27%)
Similarity:186/395 - (47%) Gaps:37/395 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYTL 105
            |:|.|...::|..|:||:||||||..::|.:.:..:...|..:|::.|:.....:......|.|.
Mouse    11 FTLELFHTLKESSPTGNIFFSPFSISSSLAMVFLGAKGSTAAQLSKTLHFDSVEDIHSCFQSLTA 75

  Fly   106 AQRQDEFRWRQSPMELSSANRIFVDRTINVSNKF---NTLLYGA-TKELDFKNDPETGLKEINDW 166
                 |.....:...|..|||::.::|.|...:|   ...:|.| ...:||::..|...||||.|
Mouse    76 -----EVSKLGASHTLKLANRLYGEKTYNFLPEFLASTQKMYSADLAAVDFQHASEDARKEINQW 135

  Fly   167 IADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHK 231
            :..:|..:|.::|:...:...|.|||.||.|.||.|..||...||...||.:|:::.:.|.||::
Mouse   136 VKGQTEGKIPELLAKGVVDSMTKLVLVNAIYFKGIWEEQFMTRETINAPFRLNKKDTKTVKMMYQ 200

  Fly   232 TGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILP---NSNKISLNRVISRL 293
            ...|.......|:.:::::||:               ..::||:|:||   ......|.::..:|
Mouse   201 KKKFPFGYISDLKCKVLEMPYQ---------------GGELSMVILLPEDIEDESTGLKKIEEQL 250

  Fly   294 NADSVKKWFERALPQKIE--LSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLT--ADPISL 354
            ....:.:|.:....:.|:  :.||:|:.|:...|...|..:||..:|:...  .||:  :....|
Mouse   251 TLGKLHEWTKHENLRNIDVHVKLPRFKMEESYILNSNLCCLGVQDLFSSGK--ADLSGMSGSRDL 313

  Fly   355 VIDDAQHLAKIKVDEVGSTAAAAT--ILLVSRSSRQPDPTK-FNCNHPFVFLIYDEKVDTILFAG 416
            .:....|.:.:.|:|.|:.|||||  |:.| ...:.|.|.: |..:|||:|.|.......::|.|
Mouse   314 FVSKIVHKSFVDVNEQGTEAAAATGGIIQV-LCEKMPTPQEVFTVDHPFLFFIRHNPTANMIFFG 377

  Fly   417 VYSDP 421
            ....|
Mouse   378 RVCSP 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 106/390 (27%)
Serpinb1bNP_766640.1 serpinB1_LEI 1..382 CDD:381028 106/393 (27%)
CARD-binding motif (CBM). /evidence=ECO:0000250|UniProtKB:P30740 352..382 8/29 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.