DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and SERPINA11

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001073920.1 Gene:SERPINA11 / 256394 HGNCID:19193 Length:422 Species:Homo sapiens


Alignment Length:400 Identity:104/400 - (26%)
Similarity:183/400 - (45%) Gaps:54/400 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVL---- 100
            :|:|.|.|::....| ||:||||.|....|.|....:...|...:.:.|........:..:    
Human    56 NFALRLYKELAADAP-GNIFFSPVSISTTLALLSLGAQANTSALILEGLGFNLTETPEADIHQGF 119

  Fly   101 --VSYTLAQRQDEFRWRQSP-MELSSANRIFVDRTINVSNKF-NTL--LYGA-TKELDFKNDPET 158
              :.:|||        ..|| :||...|.:|:|:.:.....: :::  |||| ....:|.:...|
Human   120 RSLLHTLA--------LPSPKLELKVGNSLFLDKRLKPRQHYLDSIKELYGAFAFSANFTDSVTT 176

  Fly   159 GLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEET-ALKPFFINERE 222
            | ::|||::..:|:.|:.|.|  .|.:..|.:||||..:.|.:|...|...:| ..:.||::||.
Human   177 G-RQINDYLRRQTYGQVVDCL--PEFSQDTFMVLANYIFFKAKWKHPFSRYQTQKQESFFVDERT 238

  Fly   223 QEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLN 287
            ...|.|||:....:...|:.|...::::.||                .:...:::||:..|  :.
Human   239 SLQVPMMHQKEMHRFLYDQDLACTVLQIEYR----------------GNALALLVLPDPGK--MK 285

  Fly   288 RVISRLNADSVKKWFERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTADPI 352
            :|.:.|...:::||.:..||..::|.||:|.......|..||..:|:..:....|.|..:|.. :
Human   286 QVEAALQPQTLRKWGQLLLPSLLDLHLPRFSISGTYNLEDILPQIGLTNILNLEADFSGVTGQ-L 349

  Fly   353 SLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQP------DPTKFNCNHPFVFLIYDEKVDT 411
            :..|....|.|.:.:.|.|:.|.||:.||    |:.|      || ..:.|.||:.|:::....:
Human   350 NKTISKVSHKAMVDMSEKGTEAGAASGLL----SQPPSLNTMSDP-HAHFNRPFLLLLWEVTTQS 409

  Fly   412 ILFAGVYSDP 421
            :||.|...:|
Human   410 LLFLGKVVNP 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 103/395 (26%)
SERPINA11NP_001073920.1 alpha-1-antitrypsin_like 53..416 CDD:239011 103/395 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.