DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpina3c

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_036789.2 Gene:Serpina3c / 24794 RGDID:2972 Length:416 Species:Rattus norvegicus


Alignment Length:394 Identity:102/394 - (25%)
Similarity:182/394 - (46%) Gaps:41/394 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWA-LNKQQVLVSY 103
            ||:|:|.|::....|..|:.|||.|...||.:....:.:.|..|:.:.|..... :.::::...:
  Rat    51 DFTLSLYKKLALRNPDKNVVFSPLSISAALAILSLGAKDSTMEEILEGLKFNLTEITEEEIHQGF 115

  Fly   104 -----TLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKF---NTLLYGATKEL-DFKNDPETG 159
                 .|:|.:|:       .|:::.:.:|:|:...:.::|   ...||.|...: |||...| .
  Rat   116 GHLLQRLSQPEDQ-------AEINTGSALFIDKEQPILSEFQEKTRALYQAEAFVADFKQCNE-A 172

  Fly   160 LKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQE 224
            .|.|||:::::|..:|.::.|  ::...|.:||.|....||:|...|...:|....|:::|:...
  Rat   173 KKFINDYVSNQTQGKIAELFS--DLDERTSMVLVNYLLFKGKWKVPFNPNDTFESEFYLDEKRSV 235

  Fly   225 MVYMMH-KTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNR 288
            .|.||. |........||.|...:::|.|                ..:.|.:.|||:..|  :.:
  Rat   236 KVPMMKIKDLTTPYVRDEELSCSVLELKY----------------TGNASALFILPDQGK--MQQ 282

  Fly   289 VISRLNADSVKKWFERALPQKI-ELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTADPI 352
            |.|.|..:::|||.:...|:.| ||.:|||.......|..:|..:|:..:|::.|....:|... 
  Rat   283 VESSLQPETLKKWKDSLRPRIISELRMPKFSISTDYNLEEVLPELGIRKIFSQQADLSRITGTK- 346

  Fly   353 SLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGV 417
            :|.:....|.|.:.|||.|:..||||.:..:..|........|.|.||:.:|.|....::.|.|.
  Rat   347 NLHVSQVVHKAVLDVDETGTEGAAATAVTAALKSLPQTVPLLNFNRPFMLVITDNNGQSVFFMGK 411

  Fly   418 YSDP 421
            .::|
  Rat   412 VTNP 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 101/389 (26%)
Serpina3cNP_036789.2 SERPIN 54..415 CDD:214513 99/389 (25%)
RCL 365..392 7/26 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.