DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpinb10

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:XP_006529660.1 Gene:Serpinb10 / 241197 MGIID:2138648 Length:382 Species:Mus musculus


Alignment Length:309 Identity:72/309 - (23%)
Similarity:132/309 - (42%) Gaps:56/309 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 LSSANRIFVDRTINVSNKF----NTLLYGATKELDFKNDPETGLKEINDWIADKTHNQIRDMLSS 181
            |.:||||:.::|....||:    .|......:.::|........||||.|:..:|..:|.::|..
Mouse    68 LKTANRIYGEKTYPFHNKYLEDMKTYFGAEPQSVNFVEASGQIRKEINSWVGSQTGGKIPNLLPD 132

  Fly   182 EEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQSQ 246
            :.:...|.:||.||.|.||.|..||.|:.|..:||.:|:...:.|.||....:.::...|.||:.
Mouse   133 DSVDTKTKMVLVNALYFKGTWEHQFSVKSTTERPFRVNKTTSKPVQMMSMKQSLQVFHIEELQTI 197

  Fly   247 IIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERAL--PQK 309
            .::|.|:               ..|:|::::||.:.. .|.::...:..:.:.||....:  ..:
Mouse   198 GLQLHYQ---------------NRDLSLLLLLPEAID-GLEQLERAITYEKLDKWTSADMMDTYE 246

  Fly   310 IELSLPKFQFEQRLELTPILSLMGVNTMFTR-----------NATF-GDLTADPIS--------- 353
            ::|.||||:.|:..:|...|.....:..:::           :||. ......|:|         
Mouse   247 VQLYLPKFKMEESYDLKSALRGQKFSGPYSKENNEDHLPHIYSATLDNQQNGHPVSPRHVFGNGK 311

  Fly   354 ---LVID---DAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNC 396
               ..:.   |.:.|.:..|.::...:|.||.||:|       |...:|
Mouse   312 RKHSTVSGRCDCKSLIQTFVVDIVENSALATSLLIS-------PINSSC 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 72/309 (23%)
Serpinb10XP_006529660.1 serpin 1..>277 CDD:393296 57/224 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.