DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpinb13

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_766440.2 Gene:Serpinb13 / 241196 MGIID:3042250 Length:389 Species:Mus musculus


Alignment Length:410 Identity:108/410 - (26%)
Similarity:195/410 - (47%) Gaps:60/410 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYTL 105
            |...|.|::.:. ..||:||||.....|:.:....:...|..||.:      .|..:|...|..:
Mouse    11 FLFDLFKELNKT-NDGNVFFSPVGISTAIGMIILGTRGATASELQK------VLYTEQGTESSRI 68

  Fly   106 AQRQDEFRWRQ-----------------SPMELSSANRIFVDRTINVSNKFNTLL---YGATKE- 149
            ...::|...|:                 :..:|..:||:|.::|.....|:...:   |.|:.| 
Mouse    69 KSEEEEIEKREEIHHQLQMLLTEISKFSNDYDLIISNRLFGEKTYLFLQKYIDYVEKYYHASLEP 133

  Fly   150 LDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALK 214
            :||.|..:...|:||.|:..:|:.:::|:.....:...|.|||.|..|.||.|..:||.|.|..:
Mouse   134 VDFVNAADESRKKINSWVESQTNVKVKDLFPEGSLNSSTKLVLINTVYFKGLWDREFKKEHTKEE 198

  Fly   215 PFFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILP 279
            .|::|:...:.|.||....:|..|..|.||::|:.:||:               .:||||.::||
Mouse   199 DFWLNKNLSKPVQMMALCSSFNFTFLEDLQAKIVGIPYK---------------NNDISMFVLLP 248

  Fly   280 NSNKISLNRVISRLNADSVKKW-----FERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFT 339
            |... .|.:::.:::.:.:.:|     .|:   ::::|.||:.|.|:..:|.|:|..:|:::.|:
Mouse   249 NDID-GLEKIMDKMSPEKLVEWTSPGHLEQ---RRVDLRLPRLQVEETYDLEPVLEAVGIHSAFS 309

  Fly   340 RNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAAT---ILLVSRSSRQPDPTKFNCNHPFV 401
            .:|.:..::|.. .|...:..|.:.:.|.|.|..|.|.|   :.:.|.:|.:    ..:|||||:
Mouse   310 EHADYSGMSARS-GLHAQNFLHRSFLVVTEEGVEATAGTGVGLKVSSAASCE----LVHCNHPFL 369

  Fly   402 FLIYDEKVDTILFAGVYSDP 421
            |.|...:.|:|||.|.:|.|
Mouse   370 FFIRHRESDSILFFGKFSSP 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 106/405 (26%)
Serpinb13NP_766440.2 SERPIN 4..389 CDD:294093 107/408 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.