DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpinb6d

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001070258.1 Gene:Serpinb6d / 238568 MGIID:2667783 Length:375 Species:Mus musculus


Alignment Length:388 Identity:104/388 - (26%)
Similarity:188/388 - (48%) Gaps:30/388 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYTL 105
            |:..|:|.:.: ..|.|:|.||.|..::|.:....:.|.|.|::.|.|:|....:.....:....
Mouse    11 FAFKLLKALDD-DTSKNIFLSPPSIASSLAMTLLGAKENTARQIRQTLSLDKCSSDPCEDIHQDF 74

  Fly   106 AQRQDEFRWRQSPMELSSANRIFVDRTINVSNKF---NTLLYGA-TKELDFKNDPETGLKEINDW 166
            ....:|.......:.|.:.||:||::|.::...|   :...|.| .:|||||.|.|...:.||.|
Mouse    75 HLLLNEVNKTDPGIILKTENRLFVEKTFHIKKSFKDASQKFYKAEIEELDFKGDTEQSRQHINTW 139

  Fly   167 IADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHK 231
            :...|..:|:|:||...:..:|.|||.|..|.||.|...|..|:|...||.:::...:.|.||.:
Mouse   140 VTKNTDEKIKDLLSPGSVNSNTRLVLVNDFYFKGYWEKPFNKEDTREMPFRVSKNVVKPVQMMFQ 204

  Fly   232 TGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNAD 296
            ...||:|..|.:.::|:.|||               :.:.::|||:||:.: :.|..:..::..:
Mouse   205 KSTFKITYIEEISTKILLLPY---------------AGNKLNMIIMLPDEH-VELRMLEKKMTYE 253

  Fly   297 SVKKW--FERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTR-NATFGDLTADPISLVIDD 358
            ...:|  .::...:::|:.||:|:.|:..::..:|..||:...|.. .|.|..:::.. .|.:..
Mouse   254 KFVEWTSLDKMNEEEVEVFLPRFKLEEIYDMNNVLYKMGMTDAFEEGRADFSGISSKQ-GLFLSK 317

  Fly   359 AQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDP 421
            ..:.|.|:|.|.|:..||||.:::..:|  |....|..:|||:|   ....:..:..|.:|.|
Mouse   318 VIYKAFIEVIEKGTKVAAATDIVMMGAS--PTTHTFCADHPFIF---THMTEDFMIIGRFSSP 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 102/383 (27%)
Serpinb6dNP_001070258.1 SERPIN 4..375 CDD:294093 103/386 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.