DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpina3j

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001094942.1 Gene:Serpina3j / 238395 MGIID:2182843 Length:420 Species:Mus musculus


Alignment Length:427 Identity:101/427 - (23%)
Similarity:178/427 - (41%) Gaps:72/427 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LDKPELSFLNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTEREL 84
            ||...|:.:|         .||:.:|.|::....|..|..|||.|...||......:...|..|:
Mouse    42 LDSLTLASIN---------TDFAFSLYKKLALKNPHKNFVFSPLSITIALASLSLGAKGNTLEEI 97

  Fly    85 AQAL--NL------------GWALNKQQVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINV 135
            .:.|  ||            |..|.:        |:|..|:       :::|:.|.:.|::.:.:
Mouse    98 LEGLKFNLTETPEADIHQGFGHLLQR--------LSQPGDQ-------VQISTGNSMVVEKHLQI 147

  Fly   136 ----SNKFNTLLYGATKELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAA 196
                ..|...|.:......||: .|....|.:||:::::|...|::::|  ::...|.:|:.|.|
Mouse   148 LAEFKEKARALYHTEVFTADFQ-QPREARKLLNDYVSNQTQGMIKELVS--DLEERTSMVMTNFA 209

  Fly   197 YMKGQWLSQFKVEETALKPFFINEREQEMVYMMH----KTGAFKMTIDEGLQSQIIKLPYRTIYK 257
            ...|:|...|...||.:..|..:.|....|.||.    :...|:   ||.::..:::|.|     
Mouse   210 LFNGKWNMTFDPYETFMGTFIEDRRTPVKVSMMKMKELRAPYFR---DEKMKCTVVELNY----- 266

  Fly   258 SKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQKI-ELSLPKFQFEQ 321
                       |.:...:.|||:..|  :.:|.:.|...:::.|.:...|:.| ||.||||...:
Mouse   267 -----------KGNGKAMFILPDQGK--MKQVEASLQPATLRGWRKSLRPRMIDELYLPKFSISK 318

  Fly   322 RLELTPILSLMGVNTMFTRNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSS 386
            ...|..||..:|:..:|:..|....::... .:.:....|.|.:.:.|.|:.|.|.|.......|
Mouse   319 NYRLENILPELGIKEVFSTQADLSGISGGK-DVRVSRMFHSAALDMTETGTEARATTRDKYDFLS 382

  Fly   387 RQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDPRQ 423
            .:.:||..|.|.||:|.:.....:.|.|.|..::|.|
Mouse   383 TKSNPTVVNLNTPFLFCVLHSDSENIDFMGKINNPAQ 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 95/403 (24%)
Serpina3jNP_001094942.1 serpinA3_A1AC 37..417 CDD:381019 99/423 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.