DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpina3f

DIOPT Version :10

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001028507.2 Gene:Serpina3f / 238393 MGIID:2182838 Length:445 Species:Mus musculus


Alignment Length:32 Identity:12/32 - (37%)
Similarity:13/32 - (40%) Gaps:3/32 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 DGSNGRPGNPGEDADGDDYKPDASQFCFDCPE 190
            |.|:....|..||.|.||   |.|....|..|
Mouse   262 DESDTSDDNDDEDDDDDD---DESSESSDTDE 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 serpin_crustaceans_chelicerates_insects 34..421 CDD:381059 12/32 (38%)
Serpina3fNP_001028507.2 serpinA3_A1AC 27..409 CDD:381019 12/32 (38%)
RCL 357..382
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.