DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpina3f

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001028507.2 Gene:Serpina3f / 238393 MGIID:2182838 Length:445 Species:Mus musculus


Alignment Length:413 Identity:100/413 - (24%)
Similarity:175/413 - (42%) Gaps:78/413 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYT 104
            ||:.:|.|::....|..|:.|||||...||.|....:...|.:|:.:.|             .:.
Mouse    43 DFAFSLYKELVLKNPDENVVFSPFSICTALALLSLGAKSNTLKEILEGL-------------KFN 94

  Fly   105 LAQRQDE-----FRW-------RQSPMELSSANRIFVDRTINVSNKFN---TLLYGATK-ELDFK 153
            |.:..:.     ||:       ..:.:::|:.:.:|:::.:.:..:|.   ..||.|.. ..||:
Mouse    95 LTETPEPDIHQGFRYLLDLLSQPGNQVQISTGSALFIEKHLQILAEFKEKARALYQAEAFTADFQ 159

  Fly   154 NDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFI 218
             .|....|.|||::::.|..:|::::|  ::...|::||.|..|.||:|...|..::|....|::
Mouse   160 -QPLEATKLINDYVSNHTQGKIKELIS--DLDKRTLMVLVNYIYFKGKWEMPFDPDDTCKSEFYL 221

  Fly   219 NEREQEMVYMMH----KTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILP 279
            :|.....|.||.    .|..|:   ||.|...:::|.|                ..:.|.:.|||
Mouse   222 DENRSVKVPMMKINNLTTPYFR---DEELSCTVVELKY----------------TGNASAMFILP 267

  Fly   280 NSNKISLNRVISRLNADSVKKWFERALPQKI-ELSLPKFQFEQRLELTPILSLMGVNTMFTRNAT 343
            :..|  :.:|.:.|..::::.|.:...|:.| ||.||||.......|..||..:|:..:|:..|.
Mouse   268 DQGK--MQQVEASLQPETLRNWKDSLKPRLINELCLPKFSISTDYSLEHILPELGIRELFSTQAD 330

  Fly   344 FGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAAT----------ILLVSRSSRQPDPTKFNCNH 398
            ...:|... .|......|.|.:.|.|.|:.|||.|          ::.         ..|...:.
Mouse   331 LSAITGTK-DLRTSQVVHKAVLDVAETGTEAAAGTGYQNLQCCQGVIY---------SMKIYFDR 385

  Fly   399 PFVFLIYDEKVDTILFAGVYSDP 421
            ||:.:|.|......||....|:|
Mouse   386 PFLMIISDTNTHIALFMAKVSNP 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 98/408 (24%)
Serpina3fNP_001028507.2 alpha-1-antitrypsin_like 40..405 CDD:239011 98/408 (24%)
RCL 357..382 6/33 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.