DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpinb8

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_035589.1 Gene:Serpinb8 / 20725 MGIID:894657 Length:374 Species:Mus musculus


Alignment Length:395 Identity:119/395 - (30%)
Similarity:197/395 - (49%) Gaps:45/395 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNL---GWALNKQQVLVS 102
            |:::|:|.:.|...|.||||.|.|..:||.:.|..:...|..::::.|.|   |......|.|::
Mouse    11 FAISLLKILSEKDKSRNLFFCPMSVSSALAMVYLGAKGNTATQMSEVLGLSGNGDVHQSFQTLLA 75

  Fly   103 YTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKF----NTLLYGATKELDFKNDPETGLKEI 163
                    |.....:...|.||.|:|.:.:.:..:.|    :.......:||.|..|.|...|.|
Mouse    76 --------EINKTDTQYLLKSACRLFGEESCDFLSTFKESCHKFYQAGLEELSFAKDTEGCRKHI 132

  Fly   164 NDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYM 228
            |||:::||..:|.::||...:.|.|.|||.||.|.||:|.:||..:.|...||..|: |::.|.|
Mouse   133 NDWVSEKTEGKISEVLSPGTVCPLTKLVLVNAMYFKGKWKAQFDRKYTRGMPFKTNQ-EKKTVQM 196

  Fly   229 MHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRVISRL 293
            |.|...|||...:.:..|::.|||               ::.::||:|:||:.: ..|..|...|
Mouse   197 MFKHAKFKMGHVDEVNMQVLALPY---------------AEEELSMVILLPDES-TDLAVVEKAL 245

  Fly   294 NADSVKKWF--ERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMF--TRNATFGDLTAD---P 351
            ..:.::.|.  |.....::::.||:.:.|:..:|..:|..:|:...|  || |.|..:|..   |
Mouse   246 TYEKLRAWTNPETLTESQVQVFLPRLKLEESYDLETVLQNLGMTDAFEETR-ADFSGMTTKKNVP 309

  Fly   352 ISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAG 416
            :|.|    .|...::|:|.|:.|||||.::.:....:.:| :|..:|||:|.|:..|..:|||.|
Mouse   310 VSKV----AHKCFVEVNEEGTEAAAATAVIRNARCCRTEP-RFCADHPFLFFIWHHKTSSILFCG 369

  Fly   417 VYSDP 421
            .:|.|
Mouse   370 RFSSP 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 117/390 (30%)
Serpinb8NP_035589.1 SERPIN 4..374 CDD:294093 118/393 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.