DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpinb9

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_033282.1 Gene:Serpinb9 / 20723 MGIID:106603 Length:374 Species:Mus musculus


Alignment Length:403 Identity:110/403 - (27%)
Similarity:202/403 - (50%) Gaps:38/403 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGW 92
            :|..|:   |...|::.|:|.:.:..||.|:.:||.|..:||.:....:..||..:::|||    
Mouse     1 MNTLSE---GNGTFAIHLLKMLCQSNPSKNVCYSPASISSALAMVLLGAKGQTAVQISQAL---- 58

  Fly    93 ALNKQQ-VLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKF--NTLLY--GATKELDF 152
            .|||:: :...:.|..|  :.........|..|||:|.|:|..|...|  ::|.:  ...::|.|
Mouse    59 GLNKEEGIHQGFQLLLR--KLNKPDRKYSLRVANRLFADKTCEVLQTFKESSLHFYDSEMEQLSF 121

  Fly   153 KNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFF 217
            ..:.|...:.||.|::.:|..:|.::||...:...|.|||.||.|.||:|...|..|.|...||.
Mouse   122 AEEAEVSRQHINTWVSKQTEGKIPELLSGGSVDSETRLVLINALYFKGKWHQPFNKEYTMDMPFK 186

  Fly   218 INEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSN 282
            ||:.|:..|.||.:...:.:...:.:|:|::.:||..:               ::|::::||:..
Mouse   187 INKDEKRPVQMMCREDTYNLAYVKEVQAQVLVMPYEGM---------------ELSLVVLLPDEG 236

  Fly   283 KISLNRVISRLNADSVKKWFERALPQK--IELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFG 345
             :.|::|.:.|..:.:..|.|....:.  :|:.||||:.::..::..:...:||..:|..:.  .
Mouse   237 -VDLSKVENNLTFEKLTAWMEADFMKSTDVEVFLPKFKLQEDYDMESLFQRLGVVDVFQEDK--A 298

  Fly   346 DLT--ADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEK 408
            ||:  :...:|.:....|.:.::::|.|:.||||: .::........|| |..:|||:|.|...|
Mouse   299 DLSGMSPERNLCVSKFVHQSVVEINEEGTEAAAAS-AIIEFCCASSVPT-FCADHPFLFFIRHNK 361

  Fly   409 VDTILFAGVYSDP 421
            .::|||.|.:|.|
Mouse   362 ANSILFCGRFSSP 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 106/389 (27%)
Serpinb9NP_033282.1 serpin 1..374 CDD:393296 109/401 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.