DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpine2

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_033281.1 Gene:Serpine2 / 20720 MGIID:101780 Length:397 Species:Mus musculus


Alignment Length:429 Identity:109/429 - (25%)
Similarity:188/429 - (43%) Gaps:58/429 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLPVVTIAALDKPELSFLNEFSQIFKGE--RDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAY 73
            :|..||:       .|..::|:.:...|  .:..:.:..||.:..|..|:..||....:.|.:..
Mouse     9 ILTTVTL-------YSVHSQFNSLSLEELGSNTGIQVFNQIIKSRPHENVVVSPHGIASILGMLQ 66

  Fly    74 FSSSEQTERELAQAL-----NLGWALNK-QQVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRT 132
            ..:..:|:::|:..:     .:|..|.| .:.:||            :::...::.||.:|:...
Mouse    67 LGADGKTKKQLSTVMRYNVNGVGKVLKKINKAIVS------------KKNKDIVTVANAVFLRNG 119

  Fly   133 INVSNKF----NTLLYGATKELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEIT-PHTMLVL 192
            ..:...|    ..:.....:.::|: ||.:..:.||.|:.::|...|.::||...|. ..|.|||
Mouse   120 FKMEVPFAVRNKDVFQCEVQNVNFQ-DPASASESINFWVKNETRGMIDNLLSPNLIDGALTRLVL 183

  Fly   193 ANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGAFK---MTIDEGLQSQIIKLPYRT 254
            .||.|.||.|.|:|:.|.|..:.|...:.:...|.|:.:...|:   .....||....|:|||. 
Mouse   184 VNAVYFKGLWKSRFQPESTKKRTFVAGDGKSYQVPMLAQLSVFRSGSTRTPNGLWYNFIELPYH- 247

  Fly   255 IYKSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQKIELSLPKFQF 319
                          ...|||:|.||..:...|:.:|..:...::..|....:|::::|.||||..
Mouse   248 --------------GESISMLIALPTESSTPLSAIIPHITTKTIDSWMNTMVPKRMQLVLPKFTA 298

  Fly   320 EQRLELTPILSLMGVNTMF-TRNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAA-TILLV 382
            ..:.:|...|..:|:..|| ...|.|..:|... ||.:......|||:|.|.|:.|:|| |.:|:
Mouse   299 VAQTDLKEPLKALGITEMFEPSKANFTKITRSE-SLHVSHILQKAKIEVSEDGTKASAATTAILI 362

  Fly   383 SRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDP 421
            :|||    |..|..:.||:|.|.......|||.|..:.|
Mouse   363 ARSS----PPWFIVDRPFLFSIRHNPTGAILFLGQVNKP 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 103/398 (26%)
Serpine2NP_033281.1 serpinE2_GDN 21..395 CDD:381039 104/406 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.