DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpina3m

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_033279.2 Gene:Serpina3m / 20717 MGIID:98378 Length:418 Species:Mus musculus


Alignment Length:402 Identity:102/402 - (25%)
Similarity:181/402 - (45%) Gaps:55/402 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVL---- 100
            ||:.:|.|::....|..|:.|||.|...||.|....:...|..|:.:.|........:..:    
Mouse    53 DFAFSLYKKMALKNPDKNIVFSPLSISAALALVSLGAKGNTLEEILEGLKFNLTETSEADIHQGF 117

  Fly   101 --VSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFNTLLYGATKEL--------DFKND 155
              :...|:|.:|:       .:::..|.:|:::.:.:..:|    :..|:.|        ||: .
Mouse   118 GHLLQRLSQPEDQ-------DQINIGNAMFIEKDLQILAEF----HEKTRALYQTEAFTADFQ-Q 170

  Fly   156 PETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINE 220
            |....|.|||:::::|...|:.::|  |:...|::||.|..|.||:|...|..::|....|:::|
Mouse   171 PTEATKLINDYVSNQTQGMIKKLIS--ELDDRTLMVLVNYIYFKGKWKISFDPQDTFESEFYLDE 233

  Fly   221 REQEMVYMMH----KTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNS 281
            :....|.||.    .|..|:   ||.|...:::|.|                ..:.|.:.|||:.
Mouse   234 KRSVKVPMMKMKFLTTRHFR---DEELSCSVLELKY----------------TGNASALFILPDQ 279

  Fly   282 NKISLNRVISRLNADSVKKWFERALPQKI-ELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFG 345
            .:  :.:|.:.|..::::||::....:|| ||.||||.......|..||..:|:..:|::.|...
Mouse   280 GR--MQQVEASLQPETLRKWWKSLKTRKIGELYLPKFSISTDYNLKDILPELGIKEIFSKQADLS 342

  Fly   346 DLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVD 410
            .:|... .|.:....|.|.:.|.|.|:.|||||..:....||:........|.||:.:|....|.
Mouse   343 GITGTK-DLSVSQVVHKAVLDVAETGTEAAAATGFIFGFRSRRLQTMTVQFNRPFLMVISHTGVQ 406

  Fly   411 TILFAGVYSDPR 422
            |.||....::|:
Mouse   407 TTLFMAKVTNPK 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 101/396 (26%)
Serpina3mNP_033279.2 SERPIN 56..417 CDD:214513 99/396 (25%)
RCL 367..392 8/24 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.