DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpina3n

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_033278.2 Gene:Serpina3n / 20716 MGIID:105045 Length:418 Species:Mus musculus


Alignment Length:418 Identity:103/418 - (24%)
Similarity:181/418 - (43%) Gaps:56/418 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LDKPELSFLNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTEREL 84
            ||...|:.:|         .||:.:|.|::....|..|:.|||.|...||.:....:...|..|:
Mouse    42 LDSLTLASIN---------TDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEI 97

  Fly    85 AQALNLGWALNKQQVL------VSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFN--- 140
            .:.|........:..:      :...|.|.:|:       :::|:.:.:|:::...:..:|.   
Mouse    98 LEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQ-------VQISTGSALFIEKRQQILTEFQEKA 155

  Fly   141 TLLYGATK-ELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLS 204
            ..||.|.. ..||: .|....|.|||::..:|...|::::|  ::...|::||.|..|.|.:|..
Mouse   156 RALYQAEAFTADFQ-QPRQAKKLINDYVRKQTQGMIKELVS--DLDKRTLMVLVNYIYFKAKWKV 217

  Fly   205 QFKVEETALKPFFINEREQEMVYMMH----KTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHIST 265
            .|...:|....|:..:|...:|.||.    .|..|:   ||.|...:::|.|             
Mouse   218 PFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYFR---DEELFCTVVELKY------------- 266

  Fly   266 PESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQKI-ELSLPKFQFEQRLELTPIL 329
               ..:.|.:.|||:..|  :.:|.:.|..::::||.....|:.| ||.||||.......|..:|
Mouse   267 ---TGNASAMFILPDQGK--MQQVEASLQPETLRKWKNSLKPRMIDELHLPKFSISTDYSLEDVL 326

  Fly   330 SLMGVNTMFTRNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKF 394
            |.:|:..:|:..|....:|... .|.:....|.|.:.|.|.|:.|||||.:.....|.:..|...
Mouse   327 SKLGIREVFSTQADLSAITGTK-DLRVSQVVHKAVLDVAETGTEAAAATGVKFVPMSAKLYPLTV 390

  Fly   395 NCNHPFVFLIYDEKVDTILFAGVYSDPR 422
            ..|.||:.:|:|.:.:...|....::|:
Mouse   391 YFNRPFLIMIFDTETEIAPFIAKIANPK 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 98/395 (25%)
Serpina3nNP_033278.2 serpinA3_A1AC 37..418 CDD:381019 102/416 (25%)
RCL 367..392 8/24 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.