DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpina3g

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_033277.2 Gene:Serpina3g / 20715 MGIID:105046 Length:440 Species:Mus musculus


Alignment Length:406 Identity:101/406 - (24%)
Similarity:180/406 - (44%) Gaps:55/406 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYT 104
            ||:.:|.:::....|..|:.|||||...||.|....:...|.:|:.:.|             .:.
Mouse    43 DFAFSLYRKLVLKNPDENVVFSPFSICTALALLSLGAKSNTLKEILEGL-------------KFN 94

  Fly   105 LAQRQDE-----FRW-------RQSPMELSSANRIFVDRTINVSNKFN---TLLYGATK-ELDFK 153
            |.:..:.     ||:       ..:.:::|:.:.:|:::.:.:..:|.   ..||.|.. ..||:
Mouse    95 LTETPEPDIHQGFRYLLDLLSQPGNQVQISTGSALFIEKHLQILAEFKEKARALYQAEAFTADFQ 159

  Fly   154 NDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFI 218
             .|....|.|||::::.|..:|:.::|.  :....::||.|..|.||:|.:.|...:|....|::
Mouse   160 -QPLKATKLINDYVSNHTQGKIKQLISG--LKESMLMVLVNYIYFKGKWKNPFDPNDTFKSEFYL 221

  Fly   219 NEREQEMVYMMHKTGAFKMTI--DEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNS 281
            :|:...:|.|| |||......  ||.|...:::|.|                ..:.|.:.|||:.
Mouse   222 DEKRSVIVSMM-KTGYLTTPYFRDEELSCTVVELKY----------------TGNASAMFILPDQ 269

  Fly   282 NKISLNRVISRLNADSVKKWFERALPQKI-ELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFG 345
            .:  :.:|.:.|..::::||.....|:.| ||.||||.......|..||..:|:..:|:..|...
Mouse   270 GR--MQQVEASLQPETLRKWKNSLKPRMIHELRLPKFSISTDYSLEHILPELGIREVFSTQADLS 332

  Fly   346 DLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVD 410
            .:|... .|.:....|.|.:.|.|.|:.|||||.:.........|..:...|.||:.:|.|.|..
Mouse   333 AITGTK-DLRVSQVVHKAVLDVAEKGTEAAAATGMAGVGCCAVFDFLEIFFNRPFLMIISDTKAH 396

  Fly   411 TILFAGVYSDPRQMQH 426
            ..||....::|.:.::
Mouse   397 IALFMAKVTNPERSEN 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 100/396 (25%)
Serpina3gNP_033277.2 SERPIN 46..407 CDD:214513 98/396 (25%)
RCL 357..382 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.