DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpina3k

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_035588.2 Gene:Serpina3k / 20714 MGIID:98377 Length:418 Species:Mus musculus


Alignment Length:411 Identity:104/411 - (25%)
Similarity:185/411 - (45%) Gaps:74/411 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQ------- 97
            ||:.:|.|::.......|:.|||.|...||.|....:..:|..|:.:.|........:       
Mouse    54 DFAFSLYKKLALKNQDKNIVFSPLSISAALALVSLGAKGKTMEEILEGLKFNLTETPEADIHQGF 118

  Fly    98 -QVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFNTLLYGATKEL--------DFK 153
             .:|.|.:..:.||         :::..|.:|:::.:.:..:|    :..|:.|        ||:
Mouse   119 GNLLQSLSQPEDQD---------QINIGNAMFIEKDLQILAEF----HEKTRALYQTEAFTADFQ 170

  Fly   154 NDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFI 218
             .|......|||:::::|...|:.::|  |:...|::||.|..|.||:|...|..::|....|::
Mouse   171 -QPTEAKNLINDYVSNQTQGMIKKLIS--ELDDGTLMVLVNYIYFKGKWKISFDPQDTFESEFYL 232

  Fly   219 NEREQEMVYMMHKTGAFKMTI-------DEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMII 276
            :|:....|.||      ||.:       ||.|...:::|.|                ..:.|.::
Mouse   233 DEKRSVKVPMM------KMKLLTARHFRDEELSCSVLELKY----------------TGNASALL 275

  Fly   277 ILPNSNKISLNRVISRLNADSVKKWFERALPQKI-ELSLPKFQF--EQRLELTPILSLMGVNTMF 338
            |||:..:  :.:|.:.|..::::||.:.....:| ||:||||..  :.||| ..:|..||:..:|
Mouse   276 ILPDQGR--MQQVEASLQPETLRKWRKTLFSSQIEELNLPKFSIASDYRLE-EDVLPEMGIKEVF 337

  Fly   339 TRNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAAT-ILLVSRSSRQPDPTKFNC-NHPFV 401
            |..|....:| :...|.:....|.|.:.|.|.|:.||||| ::...|.:..|..    | |.||:
Mouse   338 TEQADLSGIT-EAKKLSVSQVVHKAVLDVAETGTEAAAATGVIGGIRKAVLPAV----CFNRPFL 397

  Fly   402 FLIYDEKVDTILFAGVYSDPR 422
            .:||.....:|||....::|:
Mouse   398 IVIYHTSAQSILFMAKVNNPK 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 103/405 (25%)
Serpina3kNP_035588.2 SERPIN 57..417 CDD:214513 101/405 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.