DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpinb9f

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_899020.1 Gene:Serpinb9f / 20709 MGIID:894671 Length:377 Species:Mus musculus


Alignment Length:410 Identity:107/410 - (26%)
Similarity:195/410 - (47%) Gaps:49/410 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNL-- 90
            :|..||   ....|::.|:|.:.:..||.|:.:||.|..:||.:....:...|..::.|||:|  
Mouse     1 MNTLSQ---ANGTFAIHLLKVLCQDNPSKNVCYSPMSISSALAMVLLGAKGDTAVQICQALHLNP 62

  Fly    91 ------GWALNKQQVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFN----TLLYG 145
                  |:     |:|:.....|...::..|.       |||:||:.|..:...|.    ...:.
Mouse    63 DEDVHQGF-----QLLLHNLNKQNNQKYCLRM-------ANRLFVENTCELLPTFKESCLKFYHS 115

  Fly   146 ATKELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEE 210
            ..::|.|....|...:.||.|::.:|:.:|.|:||.:.:...|.|:||||.|..|.|..:|:...
Mouse   116 EMEQLSFAKAAEESRQHINMWVSKQTNGKIPDLLSKDSVNSQTRLILANALYFHGTWCKRFEKNR 180

  Fly   211 TALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMI 275
            |...||.||::|...|.||.:.........:.:|:|::.:||..|               |::.:
Mouse   181 TKEMPFKINKKETRPVQMMWREDTLFHAYVKEIQAQVLVMPYEGI---------------DLNFV 230

  Fly   276 IILPNSNKISLNRVISRLNADSVKKWFERALPQKIE--LSLPKFQFEQRLELTPILSLMGVNTMF 338
            ::||:.. :.:::|.:.|..:.:..|.:.....:.|  :.|||||.::..::..:|..:|:..:|
Mouse   231 VLLPDEG-VDISKVENNLTFEKLTAWTKPEFMNRTEFHVYLPKFQLQEDYDMNSLLQHLGILNVF 294

  Fly   339 TRNATFGDLT--ADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFV 401
              :.:..||:  :...:|.:.:..|...::|:|.|:.||||:.:........|||..|..:|||:
Mouse   295 --DGSKADLSGMSTKENLCLSEFVHKCVVEVNEEGTEAAAASAVEFIFLCLGPDPETFCADHPFL 357

  Fly   402 FLIYDEKVDTILFAGVYSDP 421
            |.|.....::|||.|.:|.|
Mouse   358 FFIMHSTTNSILFCGRFSSP 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 102/396 (26%)
Serpinb9fNP_899020.1 SERPIN 4..377 CDD:294093 105/405 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.