DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpina1e

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_033273.1 Gene:Serpina1e / 20704 MGIID:891967 Length:413 Species:Mus musculus


Alignment Length:401 Identity:96/401 - (23%)
Similarity:168/401 - (41%) Gaps:59/401 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWAL-------NKQ 97
            ||:::|.:::.....:.|:||||.|...|..:....|...|..::.:.|......       |..
Mouse    50 DFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHNSF 114

  Fly    98 QVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFNTLLYGATKELDFKN-------- 154
            |.|:. || .|.|      |.::||:.|.:||:..:.:..||..         :.||        
Mouse   115 QHLLQ-TL-NRPD------SELQLSTGNGLFVNNDLKLVEKFLE---------EAKNHYQAEVFS 162

  Fly   155 ----DPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKP 215
                :.|...|.|||::...|..:|.:.:  :::...|:.||||....||:|...|..|.|....
Mouse   163 VNFAESEEAKKVINDFVEKGTQGKIVEAV--KKLEQDTVFVLANYILFKGKWKKPFDPENTKQAE 225

  Fly   216 FFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPN 280
            |.::|.....|.||..:|...:.....|.|.::.:.|                ..:.:.:.:||:
Mouse   226 FHVDESTTVKVPMMTLSGMLDVHHCSTLSSWVLLMDY----------------AGNATAVFLLPD 274

  Fly   281 SNKISLNRVISRLNADSVKKWFERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFG 345
            ..|  :..:...||.:.:.|:......:..::.:|:........|..::|.:|:..:|...|...
Mouse   275 DGK--MQHLEQTLNKELISKFLLNRRRRLAQIHIPRLSISGNYNLETLMSPLGITRIFNSGADLS 337

  Fly   346 DLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVD 410
            .:|.:...|.:..|.|.|.:.:||.|:.|||||:|.....|.   |...:.|.||:|:|::|...
Mouse   338 GITEENAPLKLSQAVHKAVLTIDETGTEAAAATVLQGGFLSM---PPILHFNRPFLFIIFEEHSQ 399

  Fly   411 TILFAGVYSDP 421
            :.||.|...||
Mouse   400 SPLFVGKVVDP 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 94/396 (24%)
Serpina1eNP_033273.1 SERPIN 53..410 CDD:214513 92/396 (23%)
RCL 368..387 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.