DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpina1d

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_033272.1 Gene:Serpina1d / 20703 MGIID:891968 Length:413 Species:Mus musculus


Alignment Length:456 Identity:107/456 - (23%)
Similarity:186/456 - (40%) Gaps:88/456 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TFSLVLLA----LLPVVTIAALDKPELSFLNEFSQ---------------IFKGERDFSLALMKQ 48
            ::||:|||    |:|            |||.|..|               |.....||:|.|.::
Mouse     6 SWSLLLLAGLCCLVP------------SFLAEDVQETDTSQKDQSPASHEIATNLGDFALRLYRE 58

  Fly    49 IREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWA------LNKQQVLVSYTLAQ 107
            :.....:.|:||||.|...|..:....|...|..::.:.|.....      ::|....:..|| .
Mouse    59 LVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHKSFQHLLQTL-N 122

  Fly   108 RQDEFRWRQSPMELSSANRIFVDRTINVSNKFNTLLYGATKELDFKN------------DPETGL 160
            |.|      |.::||:.|.:||:..:.:..||..         :.||            :.|...
Mouse   123 RPD------SELQLSTGNGLFVNNDLKLVEKFLE---------EAKNHYQAEVFSVNFAESEEAK 172

  Fly   161 KEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEM 225
            |.|||::...|..:|.:.:  :::...|:..|||....||:|...|..|.|....|.::|.....
Mouse   173 KVINDFVEKGTQGKIVEAV--KKLDQDTVFALANYILFKGKWKQPFDPENTEEAEFHVDESTTVK 235

  Fly   226 VYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRVI 290
            |.||..:|...:.....|.|.::.:.|                ..:.:.:.:||:..|  :..:.
Mouse   236 VPMMTLSGMLDVHHCSMLSSWVLLMDY----------------AGNTTAVFLLPDDGK--MQHLE 282

  Fly   291 SRLNADSVKKWFERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTADPISLV 355
            ..||.:.:.::.........::.:|:........|..::|.:|:..:|...|....:|.:...|.
Mouse   283 QTLNKELISQFLLNRRRSDAQIHIPRLSISGNYNLKTLMSPLGITRIFNNGADLSGITEENAPLK 347

  Fly   356 IDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSD 420
            :..|.|.|.:.:||.|:.|||||:|.|:..| .|...:|  :|||:|:|::|...:.:|.|...|
Mouse   348 LSKAVHKAVLTIDETGTEAAAATVLQVATYS-MPPIVRF--DHPFLFIIFEEHTQSPIFVGKVVD 409

  Fly   421 P 421
            |
Mouse   410 P 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 92/398 (23%)
Serpina1dNP_033272.1 SERPIN 53..410 CDD:214513 90/395 (23%)
RCL 368..387 8/21 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.