DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpina1a

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001239498.1 Gene:Serpina1a / 20700 MGIID:891971 Length:436 Species:Mus musculus


Alignment Length:401 Identity:92/401 - (22%)
Similarity:170/401 - (42%) Gaps:59/401 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWA------LNKQQ 98
            ||:::|.:::.....:.|:||||.|...|..:....|...|..::.:.|.....      ::|..
Mouse    73 DFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHKSF 137

  Fly    99 VLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFNTLLYGATKELDFKN--------- 154
            ..:..|| .|.|      |.::||:.|.:||:..:.:..||..         :.||         
Mouse   138 QHLLQTL-NRPD------SELQLSTGNGLFVNNDLKLVEKFLE---------EAKNHYQAEVFSV 186

  Fly   155 ---DPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPF 216
               :.|...|.|||::...|..:|.:.:  :::...|:..|||....||:|...|..|.|....|
Mouse   187 NFAESEEAKKVINDFVEKGTQGKIAEAV--KKLDQDTVFALANYILFKGKWKKPFDPENTEEAEF 249

  Fly   217 FINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNS 281
            .::|.....|.||..:|...:.....|.|.::.:.|                ..:.:.:.:||:.
Mouse   250 HVDESTTVKVPMMTLSGMLHVHHCSTLSSWVLLMDY----------------AGNATAVFLLPDD 298

  Fly   282 NKIS-LNRVISRLNADSVKKWFERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFG 345
            .|:. |.:.:|:   :.:.|:......:..::..|:........|..::|.:|:..:|...|...
Mouse   299 GKMQHLEQTLSK---ELISKFLLNRRRRLAQIHFPRLSISGEYNLKTLMSPLGITRIFNNGADLS 360

  Fly   346 DLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVD 410
            .:|.:...|.:..|.|.|.:.:||.|:.|||.|:|.:...| .|...:|  :|||:|:|::|...
Mouse   361 GITEENAPLKLSQAVHKAVLTIDETGTEAAAVTVLQMVPMS-MPPILRF--DHPFLFIIFEEHTQ 422

  Fly   411 TILFAGVYSDP 421
            :.:|.|...||
Mouse   423 SPIFLGKVVDP 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 90/396 (23%)
Serpina1aNP_001239498.1 SERPIN 76..433 CDD:214513 88/396 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.