DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpinf1

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_035470.3 Gene:Serpinf1 / 20317 MGIID:108080 Length:417 Species:Mus musculus


Alignment Length:379 Identity:96/379 - (25%)
Similarity:166/379 - (43%) Gaps:48/379 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNK------QQVLVSYTLAQRQDEF 112
            |:||:..||.|...||......:..:||..:.:||......|.      :::|.|.|..::    
Mouse    73 PTGNVLLSPLSVATALSALSLGAEHRTESVIHRALYYDLITNPDIHSTYKELLASVTAPEK---- 133

  Fly   113 RWRQSPMELSSANRIFVDRTINVSNKFNTLL---YGATKELDFKNDPETGLKEINDWIADKTHNQ 174
                   .|.||:||..:|.:.|.:.|...|   || |:......:|...|:|||:|:..:...:
Mouse   134 -------NLKSASRIVFERKLRVKSSFVAPLEKSYG-TRPRILTGNPRVDLQEINNWVQAQMKGK 190

  Fly   175 IRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGA-FKMT 238
            |  ..|:.|:.....::|...||.||||:::|...:|.|:.|.::|.....|.||....| .:..
Mouse   191 I--ARSTREMPSALSILLLGVAYFKGQWVTKFDSRKTTLQDFHLDEDRTVRVPMMSDPKAILRYG 253

  Fly   239 IDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFE 303
            :|..|..:|.:||.                ...:|:|..||.:...:|..:...|.::.:.. .:
Mouse   254 LDSDLNCKIAQLPL----------------TGSMSIIFFLPLTVTQNLTMIEESLTSEFIHD-ID 301

  Fly   304 RALPQ-KIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTADPISLVIDDAQHLAKIKV 367
            |.|.. :..|::||.:.....|||..|..|.:.::| .:..|..:|..|:.|.  ..:|.|..:.
Mouse   302 RELKTIQAVLTVPKLKLSFEGELTKSLQDMKLQSLF-ESPDFSKITGKPVKLT--QVEHRAAFEW 363

  Fly   368 DEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDP 421
            :|.|:.::.:..|   :..|...|..::.|.||:|::.|.....:||.|...||
Mouse   364 NEEGAGSSPSPGL---QPVRLTFPLDYHLNQPFLFVLRDTDTGALLFIGRILDP 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 94/374 (25%)
Serpinf1NP_035470.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 17..41
PEDF 39..414 CDD:239007 94/377 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.