DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpina12

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_620180.2 Gene:Serpina12 / 191570 RGDID:708485 Length:414 Species:Rattus norvegicus


Alignment Length:438 Identity:111/438 - (25%)
Similarity:206/438 - (47%) Gaps:52/438 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SLVL---LALLPVVTIAAL----DKPELSFLNEFSQIFKGERD----------FSLALMKQIREI 52
            :|||   |.|..::|:..|    |.|:........|.::|::|          |...|::::...
  Rat     2 NLVLGLGLFLAGLLTVKGLLQDRDAPDTYESPVRVQEWRGKKDARELTRHNMEFGFKLLQRLASN 66

  Fly    53 YPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYTLAQRQDEFRWRQS 117
            ...||:|.||.|...|..:....:...|..|:.:..|.....::...:..:.|.|:.:.   ...
  Rat    67 SRQGNIFLSPLSISTAFSMLSLGAQNSTLEEIREGFNFKEMSDRDMHMGFHYLLQKLNR---ETQ 128

  Fly   118 PMELSSANRIFVDRTINVSNKFNTL---LYGATKELDFKNDPETGLKEINDWIADKTHNQIRDML 179
            .:::|..|.:|:|:.:....:|..|   ||.|...|....|.|...|.||.:|:.||||:|.:|:
  Rat   129 DVKMSIGNALFMDQRLRPQQRFLKLAKNLYDADMILTNFQDLENTQKNINKYISRKTHNRIENMV 193

  Fly   180 SSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQ 244
              :.|.|.|:::|.|..|.:|:|..:|..::|..:.|||.|.:...|.||.:.|.:.|..|..|.
  Rat   194 --KNIDPGTVMLLTNYIYFQGRWQYEFDPKQTKEEDFFIEEGKTVKVPMMFQRGMYDMAYDSQLS 256

  Fly   245 SQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQK 309
            ..|:::|||                .:|:...:||:|.|:.|  :...|.||...||......:.
  Rat   257 CTILEMPYR----------------RNITATFVLPDSGKLRL--LEQGLQADIFAKWKSLLSKRV 303

  Fly   310 IELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLT--ADPISLVIDDAQHLAKIKVDEVGS 372
            :::.:|:........:..:||.:|::.:|..:   ||||  :...||.:.:|.|.|:::::|.|:
  Rat   304 VDVWVPRLHISATYNMKKVLSRLGISKIFEEH---GDLTRISSHRSLKVGEAVHKAELRMNEKGT 365

  Fly   373 TAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILF-AGVYS 419
            ..||.:   .:::.....|.:...|.||:.:||:..:.:::| |.:|:
  Rat   366 EGAAGS---GAQTLPMETPRRMKLNAPFLMMIYENLMPSMIFLARIYN 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 100/396 (25%)
Serpina12NP_620180.2 alpha-1-antitrypsin_like 51..408 CDD:239011 98/385 (25%)
Reactive center loop. /evidence=ECO:0000250|UniProtKB:Q8IW75 364..382 3/20 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.