DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpinf2

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_032904.1 Gene:Serpinf2 / 18816 MGIID:107173 Length:491 Species:Mus musculus


Alignment Length:385 Identity:97/385 - (25%)
Similarity:167/385 - (43%) Gaps:41/385 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYTL 105
            |:..|...:.:...|.||..||.|...||......:..||...|.:.|::.         ....|
Mouse    89 FTTDLFSLVAQTSTSSNLVLSPLSVALALSHLALGAQNQTLHSLHRVLHMN---------TGSCL 144

  Fly   106 AQRQDEFRWRQSPMELSSANRIFVDRTINVSNKF---NTLLYGATKELDFKNDPETGLKEINDWI 167
            ......|.....|..:..|.||::.:...:.:.|   :..|:|| |.:......|..|..||.|:
Mouse   145 PHLLSHFYQNLGPGTIRLAARIYLQKGFPIKDDFLEQSERLFGA-KPVKLTGKQEEDLANINQWV 208

  Fly   168 ADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKT 232
            .:.|..:|.|.||  |:...|:|:|.||.:..|.|.::|....|....|.::||....|.|||..
Mouse   209 KEATEGKIEDFLS--ELPDSTVLLLLNAIHFHGFWRTKFDPSLTQKDFFHLDERFTVSVDMMHAV 271

  Fly   233 G-AFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNAD 296
            . ..:..:.|..:.|:...|:                |:::|.::::|...:.:::.|::.|..|
Mouse   272 SYPLRWFLLEQPEIQVAHFPF----------------KNNMSFVVVMPTYFEWNVSEVLANLTWD 320

  Fly   297 SVKKWFERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTADPISLVIDDAQH 361
            ::.....:..|.|:  .|||...:|:|:|...||.:|:..:|......|   ....:||:...||
Mouse   321 TLYHPSLQERPTKV--WLPKLHLQQQLDLVATLSQLGLQELFQGPDLRG---ISEQNLVVSSVQH 380

  Fly   362 LAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDP 421
            .:.:::.|.|..|||||.:.::|.|.    :.|..|.||:|.|.::.:...||.|...:|
Mouse   381 QSTMELSEAGVEAAAATSVAMNRMSL----SSFTVNRPFLFFIMEDTIGVPLFVGSVRNP 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 96/380 (25%)
Serpinf2NP_032904.1 alpha2AP 82..433 CDD:239008 96/380 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 439..491
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.