DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpina10

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_598301.2 Gene:Serpina10 / 171154 RGDID:621220 Length:436 Species:Rattus norvegicus


Alignment Length:402 Identity:100/402 - (24%)
Similarity:189/402 - (47%) Gaps:35/402 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 FLNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLG 91
            :|....|:......|..:|:::| .:...||:.||||....|::.....:..:|:.::...||| 
  Rat    60 WLRASQQLSNETSSFGFSLLRKI-SMRHDGNVIFSPFGLSVAMVNLMLGAKGETKVQVENGLNL- 122

  Fly    92 WALNKQQVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFNTL--LYGATKEL--DF 152
            .||::...|:...|.:|..|.......:.|:..:..|:.:...:...:..|  :|..|:.:  :|
  Rat   123 QALSQAGPLILPALFKRVKETFSSNKKLGLTQGSFAFIHKDFEIKKTYFNLSTMYFDTEYVPTNF 187

  Fly   153 KNDPET-GLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPF 216
            :|..:. ||  :|.:|..:|..:|..:.  :||.|.|.|:|.:....||:||:.|....|....|
  Rat   188 RNSSQARGL--MNHYINKETEGKIPKLF--DEINPETKLILVDYILFKGKWLTPFDPIFTEADTF 248

  Fly   217 FINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIIL--P 279
            .:::.:...|.||::.|.|..|.|:..:..|:||||                :.:.:|:::|  .
  Rat   249 HLDKYKAVKVPMMYREGNFASTFDKKFRCHILKLPY----------------QGNATMLVVLMEK 297

  Fly   280 NSNKISLNRVISRLNADSVKKWFERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATF 344
            :.:.::|.   ..|..|.|:.|.:....:|:|:..|||:..||.|:..:|..:|:..:|:.:|..
  Rat   298 SGDHLALE---DYLTTDLVEMWLQDMKTRKMEVFFPKFKLNQRYEMHELLKQVGIRRIFSTSADL 359

  Fly   345 GDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKV 409
            .:|:|...:|.:......:.::|||.|:...:.|   ||..:....|.....:.||.|:||:|..
  Rat   360 SELSAVARNLQVSKVVQQSVLEVDERGTEVVSGT---VSEITAYCMPPVIKVDRPFHFIIYEEMS 421

  Fly   410 DTILFAGVYSDP 421
            ..:||.|...:|
  Rat   422 QMLLFLGRVVNP 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 97/387 (25%)
Serpina10NP_598301.2 SERPIN 66..430 CDD:294093 98/391 (25%)
Heparin-binding. /evidence=ECO:0000250 128..145 4/16 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.