DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpina3c

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:XP_011242304.1 Gene:Serpina3c / 16625 MGIID:102848 Length:436 Species:Mus musculus


Alignment Length:431 Identity:104/431 - (24%)
Similarity:181/431 - (41%) Gaps:83/431 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LDKPELSFLNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTEREL 84
            ||...|:.:|         .||:.:|.|::....|..|:.|||.|...||.:....:...|..|:
Mouse    61 LDSLTLASIN---------TDFAFSLYKKLALKNPDTNIVFSPLSISAALAIVSLGAKGNTLEEI 116

  Fly    85 AQALNLGWALNKQQVLVSYTLAQRQDEFRWRQSP---------------------MELSSANRIF 128
            .:.||                      |...::|                     :::|:.:.:|
Mouse   117 LEGLN----------------------FNLTETPEADIHQGFGHLLQRLSHPGEQVQISTGSALF 159

  Fly   129 VDRTINVSNKFN---TLLYGATK-ELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTM 189
            |::.:.:..:|.   ..||.|.. ..||: .|....|.|||:::::|..:|:.::|  ::...|:
Mouse   160 VEKHLQILAEFQEKARALYQAEAFTADFQ-QPLEATKLINDYVSNQTQRKIKGLIS--DLDTDTL 221

  Fly   190 LVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMH-KTGAFKMTIDEGLQSQIIKLPYR 253
            :||.|..|.||:|...|...:|....|:::.:....|.||. ||.......||.|...:::|.| 
Mouse   222 MVLVNYIYFKGKWKMPFNPRDTFESEFYLDVKRSVKVPMMKIKTLTTPYFRDEELSCTVVELKY- 285

  Fly   254 TIYKSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQKI-ELSLPKF 317
                           |.:.|.:.|||:..:  :.:|.:.|..::::||.....|:|: ||.||||
Mouse   286 ---------------KGNASALFILPDQGR--MQQVEASLQPETLRKWKNSLRPRKMGELYLPKF 333

  Fly   318 QFEQRLELTPILSLMGVNTMFTRNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLV 382
            .......|..||..:|:..:|::.|....:|... .|::....|.|.:.|.|.|:...|||.:..
Mouse   334 SISTDYSLKNILPELGIKEIFSKQADLSGITGTK-DLIVSQMVHKAVLDVAETGTEGVAATGVNF 397

  Fly   383 SRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDPRQ 423
            ...||:   |....|..|:.:|....|.|.||....:.|::
Mouse   398 RILSRR---TSLWFNRTFLMVISHTDVQTTLFIAKITHPKR 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 99/407 (24%)
Serpina3cXP_011242304.1 serpinA3_A1AC 56..434 CDD:381019 103/428 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.