DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and SERPINA12

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001291390.1 Gene:SERPINA12 / 145264 HGNCID:18359 Length:414 Species:Homo sapiens


Alignment Length:440 Identity:115/440 - (26%)
Similarity:204/440 - (46%) Gaps:62/440 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLLALLPVVTIAALDKPELS-----FLNEF---------SQIFKGERDFSLALMKQIREIYPSGN 57
            :.||:|  :|:..|.||..|     .|:|.         .::.:...|....|:|::....|..|
Human     9 IFLAVL--LTVKGLLKPSFSPRNYKALSEVQGWKQRMAAKELARQNMDLGFKLLKKLAFYNPGRN 71

  Fly    58 LFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWA----LNKQQVLVSYTLAQRQDEFRWRQSP 118
            :|.||.|...|..:....:.:.|..|:.|..|....    |::....:.:.|.|:..:       
Human    72 IFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQD------- 129

  Fly   119 MELSSANRIFVDRTINVSNKF-----NTLLYGATKELDFKNDPETGLKEINDWIADKTHNQIRDM 178
            ::||..|.:|:|:.:....||     |  .|.|...|....:.|...|:|||:|:.|||.:|.::
Human   130 LKLSIGNTLFIDQRLQPQRKFLEDAKN--FYSAETILTNFQNLEMAQKQINDFISQKTHGKINNL 192

  Fly   179 LSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGAFKMTIDEGL 243
            :  |.|.|.|:::|||..:.:.:|..:|....|..:.||:.:.....|.||.::|.:::..|:.|
Human   193 I--ENIDPGTVMLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKL 255

  Fly   244 QSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQ 308
            ...|:::||                :.:|:.|.|||:..|  |..:...|..|:..:|......:
Human   256 SCTILEIPY----------------QKNITAIFILPDEGK--LKHLEKGLQVDTFSRWKTLLSRR 302

  Fly   309 KIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLT--ADPISLVIDDAQHLAKIKVDEVG 371
            .:::|:|:.......:|...||.:||:.:|..:   ||||  |...||.:.:|.|.|::|:||.|
Human   303 VVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEH---GDLTKIAPHRSLKVGEAVHKAELKMDERG 364

  Fly   372 STAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDP 421
            :..||.|   .:::.....|.....:.|::.|||.||:.::||.|...:|
Human   365 TEGAAGT---GAQTLPMETPLVVKIDKPYLLLIYSEKIPSVLFLGKIVNP 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 104/391 (27%)
SERPINA12NP_001291390.1 serpinA12_vaspin 40..411 CDD:381026 104/405 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.