DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and SERPINA3

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001076.2 Gene:SERPINA3 / 12 HGNCID:16 Length:423 Species:Homo sapiens


Alignment Length:400 Identity:106/400 - (26%)
Similarity:183/400 - (45%) Gaps:48/400 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWA-LNKQQVLVSY 103
            ||:.:|.||:....|..|:.|||.|...||......:...|..|:.:.|..... .::.::..|:
Human    55 DFAFSLYKQLVLKAPDKNVIFSPLSISTALAFLSLGAHNTTLTEILKGLKFNLTETSEAEIHQSF 119

  Fly   104 -----TLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFN---TLLYGATK-ELDFKNDPETG 159
                 ||.|..||       ::||..|.:||...:::.::|.   ..|||:.. ..||: |....
Human   120 QHLLRTLNQSSDE-------LQLSMGNAMFVKEQLSLLDRFTEDAKRLYGSEAFATDFQ-DSAAA 176

  Fly   160 LKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQE 224
            .|.|||::.:.|..:|.|::  :::...||:||.|..:.|.:|...|..::|....|::::::..
Human   177 KKLINDYVKNGTRGKITDLI--KDLDSQTMMVLVNYIFFKAKWEMPFDPQDTHQSRFYLSKKKWV 239

  Fly   225 MVYMMHKTGAFKMTI----DEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKIS 285
            ||.||   ....:||    ||.|...:::|.|                ..:.|.:.|||:.:|  
Human   240 MVPMM---SLHHLTIPYFRDEELSCTVVELKY----------------TGNASALFILPDQDK-- 283

  Fly   286 LNRVISRLNADSVKKWFERALPQKI-ELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTA 349
            :..|.:.|..:::|:|.:....::| ||.||||...:...|..||..:|:...||..|....:|.
Human   284 MEEVEAMLLPETLKRWRDSLEFREIGELYLPKFSISRDYNLNDILLQLGIEEAFTSKADLSGITG 348

  Fly   350 DPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDP-TKFNCNHPFVFLIYDEKVDTIL 413
             ..:|.:....|.|.:.|.|.|:.|:|||.:.::..|...:. |....|.||:.:|.......|.
Human   349 -ARNLAVSQVVHKAVLDVFEEGTEASAATAVKITLLSALVETRTIVRFNRPFLMIIVPTDTQNIF 412

  Fly   414 FAGVYSDPRQ 423
            |....::|:|
Human   413 FMSKVTNPKQ 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 104/393 (26%)
SERPINA3NP_001076.2 serpinA3_A1AC 40..421 CDD:381019 104/397 (26%)
RCL 369..394 7/24 (29%)
O-glycosylated at one site 381..389 1/7 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.