DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpinb7

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_569088.1 Gene:Serpinb7 / 117092 RGDID:71063 Length:380 Species:Rattus norvegicus


Alignment Length:402 Identity:111/402 - (27%)
Similarity:180/402 - (44%) Gaps:51/402 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNL------GWALNKQQ 98
            :|...|.:::.....:||:|||..|.:.||.|....:.....|::.:||:.      |.:.|.|.
  Rat    10 EFGFDLFREMDSSQGNGNVFFSSLSIFTALSLIRLGARGDCARQIDKALHFISPSRQGNSSNSQL 74

  Fly    99 VLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFNTL---LYGATKE-LDFKNDPETG 159
            .| .|.|.:...:........|||.||.:|.::..:....:...   ||.|..| :||.||.:..
  Rat    75 GL-QYQLKRVLADINSSHKDYELSIANGVFAEKVFDFHKSYMECAENLYNAKVERVDFTNDIQET 138

  Fly   160 LKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQE 224
            ..:||.||.::||.:|:.:|....::...::||.||.|.||:|.|.|...:|....|.......:
  Rat   139 RFKINKWIENETHGKIKKVLGDSSLSSSAVMVLVNAVYFKGKWKSAFTKSDTLSCHFRSPSGPGK 203

  Fly   225 MVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRV 289
            .|.|||:...|.::..:....||::|.|.                ..|||.|:||..:   |:.:
  Rat   204 AVNMMHQERRFNLSTIQEPPMQILELQYH----------------GGISMYIMLPEDD---LSEI 249

  Fly   290 ISRLNADSVKKW--FERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLT--AD 350
            .|:|:..::..|  ..:...|.:.:.||:|:.|:..|:...|..:|:..:|..:.  .||:  |.
  Rat   250 ESKLSFQNLMDWTNSRKMKSQYVNVFLPQFKIEKDYEMRSHLKSVGLEDIFVESR--ADLSGIAS 312

  Fly   351 PISLVIDDAQHLAKIKVDEVGSTAAAAT------ILLVSRSSRQPDPTKFNCNHPFVFLIYDEKV 409
            ...|.:....|.:.|:|.|.|:.|.|||      .||       |:.|.|..:.||:|:|  .|.
  Rat   313 GGRLYVSKLMHKSLIEVSEEGTEATAATESNIVEKLL-------PESTVFRADRPFLFVI--RKN 368

  Fly   410 DTILFAGVYSDP 421
            ..|||.|..|.|
  Rat   369 GIILFTGKVSCP 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 109/397 (27%)
Serpinb7NP_569088.1 SERPIN 4..380 CDD:294093 110/400 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.