DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpini1

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_446231.1 Gene:Serpini1 / 116459 RGDID:619896 Length:410 Species:Rattus norvegicus


Alignment Length:445 Identity:112/445 - (25%)
Similarity:199/445 - (44%) Gaps:77/445 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVLLALLPVVTIAALDKPELSFLNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALL 70
            |.|:||..:||.||.....::             ::|:.:...:|......|:.|||.|...|:.
  Rat     7 LSLVALQSLVTGAAFPDETIA-------------EWSVNVYNHLRATGEDENILFSPLSIALAMG 58

  Fly    71 LAYFSSSEQTERELAQALNLGWALNKQQVLVSYTLAQRQDEFRW----------RQSPMELSSAN 125
            :....:...|.:|:..::             .|...:..:||.:          .:....:..||
  Rat    59 VMELGAQGSTLKEIRHSM-------------GYESLKSGEEFSFLRDFSSMVSAEEGQYVMKIAN 110

  Fly   126 RIFVDRTINVSNKFNTLL---YGA-TKELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITP 186
            .:||....:::.:|..::   :.| ...:||..:.... ..||.|:.:.|::.::|::|..:...
  Rat   111 SLFVQNGFHINEEFLQMMKMYFNAEVNHVDFSENVAVA-NYINKWVENYTNSLLKDLVSPGDFDA 174

  Fly   187 HTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGAFKM------TIDEGLQS 245
            .|.|.|.||.|.||.|.|||:.|.|....|..::..:..:.||::.|.|..      :.:.|...
  Rat   175 VTHLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIY 239

  Fly   246 QIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQKI 310
            |::::||               ...:|||:::| :..::.|..:...|....:::|......||:
  Rat   240 QVLEIPY---------------EGDEISMMLVL-SRQEVPLATLEPLLKPQLIEEWANSVKKQKV 288

  Fly   311 ELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTA--DPISLVIDDAQHLAKIKVDEVGST 373
            |:.||:|..||.::|..||..:||..:|.::|   :|||  |...|.:..|.|.:.|:|:|.||.
  Rat   289 EVYLPRFTVEQEIDLKDILKALGVTEIFIKDA---NLTAMSDKKELFLSKAVHKSFIEVNEEGSE 350

  Fly   374 AAAAT-ILLVSRSSRQPDPTKFN---CNHPFVFLIYDEKVDTILFAGVYSDPRQM 424
            ||.|: ::.:||.:     ..|.   .:|||:|||.:.|..||||.|....|..|
  Rat   351 AAVASGMIAISRMA-----VLFPQVIVDHPFLFLIKNRKTGTILFMGRVMHPETM 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 102/406 (25%)
Serpini1NP_446231.1 neuroserpin 23..410 CDD:239003 104/429 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.