DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and LOC100909605

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:XP_006240581.2 Gene:LOC100909605 / 100909605 RGDID:6502633 Length:410 Species:Rattus norvegicus


Alignment Length:420 Identity:105/420 - (25%)
Similarity:186/420 - (44%) Gaps:58/420 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LDKPELSFLNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTEREL 84
            :|...||..|         .||:.:|.|::....|..|:.||.||...||:|....:...|.:|:
  Rat    32 VDSSTLSSCN---------TDFAFSLYKELVLKNPDKNIVFSSFSISTALVLLSLGAKNNTLKEI 87

  Fly    85 AQALNLGWALNKQ-QVLVSYT-LAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFN---TLLY 144
            .:.|........: ::...|. |.||   .......:::|:.:.:|:.:.:.:..:|.   ..||
  Rat    88 LEGLKFNLTETPEAEIHQGYEHLLQR---LNLPGDQVQISTGSALFIKKHLQILAEFQEKARALY 149

  Fly   145 GATK-ELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKV 208
            .|.. ..||: .|....|.|||::..:|..:|::::|  .:...|.:||.|..|.||:|...|..
  Rat   150 QAEAFSTDFQ-QPHEAKKLINDYVRKQTQGKIKELIS--VLDKKTSMVLVNYIYFKGKWKMPFDP 211

  Fly   209 EETALKPFFINEREQEMVYMMH----KTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESK 269
            .:|....|:::|::...|.||.    .|..|:   ||.|...:::|.|                .
  Rat   212 HDTFQSEFYLDEKKSVKVPMMKIEKLTTPYFR---DEELSCSVLELKY----------------T 257

  Fly   270 SDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQKI-ELSLPKFQFEQRLELTPILSLMG 333
            .:.|.:.|||:..:  :.:|.:.|..:::::|.:...|::| ||.:|||.....:.|..||..:|
  Rat   258 GNASALFILPDQGR--MQQVEASLQPETLRRWKDTLRPRRIDELRMPKFSISTDMRLGDILPELG 320

  Fly   334 VNTMFTRNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKF---- 394
            :..:|::.|....:|... .|.:....|.|.:.|.|.|:.|||||.:.:.     |...||    
  Rat   321 IREVFSQQADLSRITGAK-DLSVSQVVHKAVLDVTETGTEAAAATGVKII-----PMCAKFYYVT 379

  Fly   395 -NCNHPFVFLIYDEKVDTILFAGVYSDPRQ 423
             ..|.||:.:|.|......||....::|::
  Rat   380 MYFNRPFLMIISDTNTHIALFMAKVTNPKE 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 100/396 (25%)
LOC100909605XP_006240581.2 alpha-1-antitrypsin_like 41..404 CDD:239011 101/404 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.