DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and serpina10

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:XP_012824917.1 Gene:serpina10 / 100487295 XenbaseID:XB-GENE-983018 Length:437 Species:Xenopus tropicalis


Alignment Length:426 Identity:114/426 - (26%)
Similarity:184/426 - (43%) Gaps:78/426 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LSFLNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFS---------------TYNALL--LA 72
            |||.| .||:   ..||...|.::|...: ..|:||||||               ||:.||  |.
 Frog    64 LSFAN-VSQM---SSDFGFNLYRKIANKH-DNNIFFSPFSVSLGLSSLLLGTRGNTYDQLLHGLN 123

  Fly    73 YFSSSEQTE----RELAQALNLGWALNKQQVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTI 133
            |....:|..    .||.:.:....|.|::.||...:|:...:.|..:              |..:
 Frog   124 YNPFKDQENPYLLPELLKTIKEKIAKNEELVLNIGSLSFLHETFSMK--------------DEFV 174

  Fly   134 NVSNKFNTLLYGATKELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYM 198
            |::.|:..:.|   :.:||.:  .....|||.::...|...|.:..  :.|.|.|.|:|.:..:.
 Frog   175 NLTKKYFDMEY---ELIDFHS--SKAKNEINAYVEKLTKGLISNFY--DFIDPQTKLLLLDYIFF 232

  Fly   199 KGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETH- 262
            ||:|...|....|.:..|||::.....|.||:||.......|:.|...:.|||||     ...| 
 Frog   233 KGKWQYPFNPALTEVDSFFIDKYNSVTVPMMYKTDKVASVFDKDLSCTVFKLPYR-----GNAHM 292

  Fly   263 -ISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQKIELSLPKFQFEQRLELT 326
             |..||.:.|..::              ...|..:.:..|..:...:|.::..|||:.:|:.:|.
 Frog   293 LIIKPEKEGDFGIL--------------EDHLTKELINSWQAKMQSRKTDIFFPKFKLDQKYKLK 343

  Fly   327 PILSLMGVNTMFTRNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAA---ATILLVSRSSRQ 388
            ..|:.:|:..:||..|...|||.:. :|::.:....|.|:|||.|:.|||   |.|:..|.    
 Frog   344 SSLNELGIKELFTGKANLTDLTEER-NLMLTEITQQAMIEVDERGTEAAAVAGAEIIAYSL---- 403

  Fly   389 PDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDPRQM 424
              |.....|.||:|:|::|...::||.|...||.::
 Frog   404 --PLTIRVNRPFLFMIFEEAYQSLLFLGRVMDPTKL 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 106/406 (26%)
serpina10XP_012824917.1 serpinA10_PZI 58..436 CDD:381011 114/423 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.