DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and serpine1

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001108031.1 Gene:serpine1 / 100136840 ZFINID:ZDB-GENE-070912-60 Length:384 Species:Danio rerio


Alignment Length:420 Identity:106/420 - (25%)
Similarity:186/420 - (44%) Gaps:54/420 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LPVVTIAALDKPELSFLNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSS 76
            |.|:.|.||....|..|.:..|     .||.|.:..:..:..|..||..||:...:.|.:|...:
Zfish     4 LSVLLIFALCASSLCNLIQDKQ-----TDFGLQVFAEAVQSAPDRNLALSPYGIASVLGMAQMGA 63

  Fly    77 SEQTERELAQALNLGWALNKQQVLVSYTLAQRQDEFRWRQSPMELSS------ANRIFVDRTINV 135
            ...|.:.||.  .:|::|.::.:.....|.||           :|:|      |:.:.|||.|.:
Zfish    64 YGATLKLLAS--KMGYSLQERGMPKLQRLLQR-----------DLASEDGVEVASGVMVDRKIIL 115

  Fly   136 SNKFNTLLYGATK----ELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAA 196
            ...|...|..|.:    ::|| :.||...:.||.|.:|.|...|.:.|.|..::..|.||..||.
Zfish   116 EKVFRRSLSKAFQSVPHQIDF-SQPEMARQVINSWTSDHTDGMISEFLPSGVLSELTRLVFLNAL 179

  Fly   197 YMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGAF---KMTIDEGLQSQIIKLPYRTIYKS 258
            :..|.|.:.|....|..:.|.........|.||..|..|   :....:|:...:|::||      
Zfish   180 HFHGVWKTPFDPRNTREQLFHTVNGSAVSVPMMTTTQKFNYGEFVSKDGVDYDVIEMPY------ 238

  Fly   259 KETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQKIELSLPKFQFEQRL 323
                    |.:| |||:::.|....:.|:.:...|::..:.:|.:.......:||:|:|..:..:
Zfish   239 --------EGES-ISMLLVTPFEKDVPLSALNKELSSSRIHQWRQEMRKISKQLSIPRFSMDTEI 294

  Fly   324 ELTPILSLMGVNTMFTRN-ATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLV-SRSS 386
            :|...||.||:..:|::: |.|..:|.:. .|.:.......|::|:|.|:..::||..:: ||.:
Zfish   295 DLKSTLSRMGLGDIFSQSRADFSRITTEE-PLCVSKVLQRVKLEVNEEGTKGSSATAAVIYSRMA 358

  Fly   387 RQPDPTKFNCNHPFVFLIYDEKVDTILFAG 416
            .:    :...:.||.|||..:....:||:|
Zfish   359 VE----EITLDRPFFFLIQHKPTGALLFSG 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 98/395 (25%)
serpine1NP_001108031.1 SERPIN 26..384 CDD:294093 97/391 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.